KEGG   Rhizobium sp. LPU83: LPU83_pLPU83c0480Help
Entry
LPU83_pLPU83c0480 CDS       T03046                                 

Gene name
treS
Definition
maltose alpha-D-glucosyltransferase (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rhl  Rhizobium sp. LPU83
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LPU83_pLPU83c0480 (treS)
Enzymes [BR:rhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LPU83_pLPU83c0480 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     LPU83_pLPU83c0480 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
pLPU83c:445177..448485
Genome map
AA seq 1102 aa AA seqDB search
MDTMTVSHGPLTDTDAPEPDPLWYKDAVIYQLHIKSFFDANGDGIGDFTGLHEKLDHIEA
LGANTIWLLPFFPSPRRDDGYDIADYTNISSDYGTTEEFKAFVEAAHQRGLRVIIELVIN
HTSDQHPWFQRARLAPLGSPEREFYVWSDTDQKFPETRIIFLDTEKSNWTWDAVAGAYYW
HRFYSHQPDLNFDNPLVLEELLGVMRFWLETGIDGFRLDAIPYLVEREGTINENLPETHA
ILKKIRSALDATHPGKMLLAEANQWPEDTREYFGDGDECHMAFHFPLMPRMYMAIAKEDR
FPITDIMRQTPEIPENCQWAIFLRNHDELTLEMVTDEERDYLWNIYAADRRARINLGIRR
RLSPLMERDRRRVELMNALLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRN
GGFSRADPARLVLPPIMDPLYGYEAVNVEAQAADAHSLFNWTRHMLALRNRHMAFGRGTL
RFLAPGNRKILAYLREYDNETILCVGNLSRLPQAVELDLAQFDGRVPIELTGMSPFPPIG
RLTYLLTLPPYGFFWFKLAQDADGPAWRTEPPEQLQDMMTVVVRRNLQELVDEPTLSRTL
SNEVLPAYLAKRRWFGGKGEPLRRACLVAATPLPFAGNLLLGELEAELDGRVDTYLLPLA
VSWDDSQPTALAQQLAFARLRQSRRVGFLTDGFVMEGLARGVVRGLCEHAVISGRTGRLE
FLGTEQLDCMHVNDDVPVRWISAEQSNSSLIIGDMAMVKLIRHIFPGTHPEVEMTRHLTQ
VGYKNTAQLLGEVARIAPDGSRYTFIIVQAAIRNQGDAWDWMLSNLRRSIDEILVIGLDE
EMMDEHFKPLVDFVAAAGKRLGELHAALARPTDDEAFKPVRMSNADAEALGNAVKKQIKA
SLAILEETRDSLAPAIAQQIGPLIEEREDLLNAASHLAKAAAGTLMIRNHGDFHLGQILV
SEGDAYIIDFEGEPTRDLDERRAKTNPLRDVAGLLRSLSYLAASADLDTDVVSQVDSERN
AALVARFIEMAEAAFLQAYFDAIDNARDLRIPAHSRGRIIDLFLLEKAAYEIAYEAHNRP
NWLALPVAGLSAIASRLLENVA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatgaccgtaagccatggcccactcactgacaccgacgcgcccgagcccgat
cccctgtggtacaaggacgcggtcatctaccaacttcacatcaaatcgttcttcgatgcc
aatggcgatggtattggcgacttcacgggcttgcacgaaaagctcgatcatattgaagcg
cttggtgccaatacgatctggctgctgccgtttttcccttcgccacgtcgtgacgacgga
tatgatatcgccgactataccaatatcagctcggactacggcacgacggaagaattcaaa
gccttcgtcgaagcggctcaccaacgcggtcttcgcgtgatcatcgagctcgtcatcaat
cacacgtccgaccagcacccatggttccagcgagcccgcttggcccctcttggctctccg
gagcgggagttctatgtctggtcggatacggatcagaaattcccggaaacgcgcatcatc
tttctcgacaccgaaaagtccaactggacctgggacgcagtggctggcgcgtattattgg
caccggttctactcccaccagcccgacctcaatttcgataatccgctggtcctggaggaa
cttctgggcgtaatgcggttctggcttgaaaccggcatcgatggcttccggctcgacgcc
atcccttatctggtcgagagagaaggcacgatcaacgagaaccttccggagacgcacgcg
atcctgaagaaaatccgctctgctctcgatgcgacacatccaggcaagatgctccttgcc
gaagccaatcagtggccggaggatacgcgcgaatatttcggcgacggcgacgagtgccat
atggcattccacttcccgctcatgccgcgcatgtatatggcgatcgccaaggaagatcgc
ttccctatcaccgacattatgcggcagacgccggaaatccctgagaattgtcagtgggcg
atctttcttcgcaaccatgacgagctgacgctcgaaatggtgactgatgaagagcgcgac
tatctctggaacatctatgccgccgaccgccgcgcccgcattaatctcggcatccggcgc
cgtctttcaccgctcatggagcgcgaccgtcgccgcgtcgagttgatgaacgccctgttg
ctctccatgccgggtacaccggtgatctattatggcgacgagatcggaatgggcgacaat
atctatcttggcgaccgcgatggtgtgcgcacgccgatgcaatggtctccggaccgcaac
ggcgggttttcccgagccgacccggcacggctcgtgctgccgcctatcatggatcctctt
tatggctacgaggcggtgaacgtcgaggcgcaagcagccgacgcgcactcgttgttcaac
tggacccgacacatgctggccttgcgcaataggcacatggcctttggacgcggcaccttg
aggttcctggcgcctggcaaccgcaagatcctggcatacttgcgtgaatacgataacgag
acgatcctttgcgtcggaaacctttcccggctgccgcaggccgtcgaactcgatctcgcg
cagtttgacggccgcgtgccgattgagctgacgggcatgtctccattcccgccgattggt
cggctcacctacctgctcacgcttccgccatacgggttcttctggttcaagctcgctcag
gacgcagatggacctgcctggcgcaccgaacctcccgagcagttgcaggacatgatgacc
gtagtggtgcggcgcaatctgcaggaattggtcgacgagccaacgctttcgcggacgctc
tcgaacgaggttctgccggcctatctcgccaagcggcgctggttcggcggcaagggcgag
ccgttaaggcgtgcctgcctcgtggccgcgacgccacttccctttgccggcaacctcctc
ttgggagaactggaggcagagcttgatgggcgcgtcgacacctatctcctgccgcttgcg
gtttcgtgggacgacagtcagccgactgcgcttgcgcagcaactggcttttgcccgcctc
cgtcaaagccgacgcgtggggtttttaaccgacggttttgtaatggagggtctcgcacgc
ggcgtcgtccgcgggctctgtgaacatgcagtaatctccggccgcaccggcagactggaa
ttcctcggcacggagcagctggactgcatgcacgtcaacgatgacgtgccggtgcggtgg
atctcagccgagcaatccaacagttccttgatcatcggcgacatggcgatggtaaagctc
atccgccatatcttcccaggcacccatcccgaggtggagatgacccgccacctcacccaa
gttgggtacaaaaatacggcgcagctgctcggcgaagtcgcgcgcattgccccggatggc
agcaggtacacgttcatcatcgtgcaggcggccatccgcaatcaaggcgatgcctgggac
tggatgctcagcaatcttcgccgctcgatcgatgagatactggttatcggccttgacgag
gaaatgatggacgagcatttcaaaccgctcgtcgactttgtcgctgcagccggcaaacgc
ctcggcgaattgcatgcggcgctggcgcggccaaccgatgatgaggctttcaaaccggtc
aggatgtccaacgcggatgccgaagcactgggaaacgccgtcaagaagcaaatcaaggcc
agcctcgccattctcgaggagacccgcgacagcctggctccggcgatcgctcaacagatc
gggccgctcatcgaagaacgcgaggacctgttgaatgcagccagccatcttgctaaggct
gcagctggtaccctcatgatccgcaatcatggcgactttcatcttggccagatcctggtc
tcggagggcgatgcctacatcatcgattttgagggcgaacccacccgagatcttgacgaa
cgtcgcgccaagaccaatccgctgcgagacgtcgcagggctactgagatcactcagctat
ttggcggcgtcggcagatcttgacacagacgtggtgagccaggtggatagcgagaggaat
gcggcgctcgtggcacgctttatcgaaatggccgaagcagcattcctccaagcctatttc
gacgcgatcgacaacgcccgagacctcagaattccagcacattcacgcggtcgcatcatc
gatctgttcctgttggagaaggcggcctatgagatcgcctatgaggcccataaccgtccc
aattggctggccctaccggttgccggtttgtcggccatcgcatccaggctcttggagaac
gtcgcatga

DBGET integrated database retrieval system