KEGG   Rhizobium favelukesii: LPU83_pLPU83d0283Help
Entry
LPU83_pLPU83d0283 CDS       T03046                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase, cytosolic 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00071  Fatty acid degradation
rhl00072  Synthesis and degradation of ketone bodies
rhl00280  Valine, leucine and isoleucine degradation
rhl00310  Lysine degradation
rhl00362  Benzoate degradation
rhl00380  Tryptophan metabolism
rhl00620  Pyruvate metabolism
rhl00630  Glyoxylate and dicarboxylate metabolism
rhl00640  Propanoate metabolism
rhl00650  Butanoate metabolism
rhl00900  Terpenoid backbone biosynthesis
rhl01100  Metabolic pathways
rhl01110  Biosynthesis of secondary metabolites
rhl01120  Microbial metabolism in diverse environments
rhl01130  Biosynthesis of antibiotics
rhl01200  Carbon metabolism
rhl01212  Fatty acid metabolism
rhl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPU83_pLPU83d0283
   00630 Glyoxylate and dicarboxylate metabolism
    LPU83_pLPU83d0283
   00640 Propanoate metabolism
    LPU83_pLPU83d0283
   00650 Butanoate metabolism
    LPU83_pLPU83d0283
  Lipid metabolism
   00071 Fatty acid degradation
    LPU83_pLPU83d0283
   00072 Synthesis and degradation of ketone bodies
    LPU83_pLPU83d0283
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPU83_pLPU83d0283
   00310 Lysine degradation
    LPU83_pLPU83d0283
   00380 Tryptophan metabolism
    LPU83_pLPU83d0283
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPU83_pLPU83d0283
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPU83_pLPU83d0283
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LPU83_pLPU83d0283
Enzymes [BR:rhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPU83_pLPU83d0283
Exosome [BR:rhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPU83_pLPU83d0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Position
pLPU83d:complement(322028..323215)
Genome map
AA seq 395 aa AA seqDB search
MALQDPIVIVGAARTPIGGFQGELKEAAAPELGAAVIRAALQRSLVEHDAVDEVVFGCVL
PAGQGQAPARQAAIGAGLPFSTGASTVNKMCGSGMKAVMLTHDLLATGSATVGVAGGMES
MTNAPYLLDRARGGYRLGHGRVIDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
HYAVTSLMRAQKAIEAGYFDAEITPVSVTAGKGEQMVSRDEQPGKARIDKIPLLKPAFRD
GGTVTAANSSSISDGAAALVLMRRSEAERRGLNALATISGHATHSQAPNLFATAPIGALQ
KLSDRIGWPLDTVDLFEINEAFAVVAMAAMRDLRLPDEKVNVHGGACALGHPIGASGARI
LVTLLAALERYELKRGMAALCIGGGEATAVAIERH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcaggaccctatcgtcatcgtcggtgcagcgcgcacgccgatcggcggtttc
caaggtgaactcaaagaggcagccgcacccgagctcggggccgctgttatccgcgcggcg
cttcagcgcagcctggtcgagcacgatgccgtcgacgaggtcgtgttcggctgcgtattg
ccggcaggccagggccaggcacctgcccggcaggcggcaatcggggcaggcctgcccttt
tccaccggcgccagcaccgtcaacaagatgtgtggctccgggatgaaagccgtcatgctg
acgcatgatcttctggcgacgggaagcgccactgtcggcgtcgccggcggcatggaaagc
atgaccaatgcgccctatctccttgatcgtgcccgtggcggctaccggcttggccacggg
cgcgtcatcgatcatatgttcctcgacgggctggaggacgcttatgacaagggacgcttg
atgggcaccttcgccgaggactgcgccgaggcatatcagttcacgcgcgaggcgcaggac
cattatgcggtcacatcgctgatgcgcgcgcaaaaggccatcgaggccggctacttcgac
gccgagatcacgccggtctccgtcaccgcgggaaagggcgaacagatggtcagccgagac
gaacagcccggcaaggcaaggatcgacaagattccgctcctcaaaccggccttccgcgac
ggcggtaccgtgaccgcagccaactccagttcgatctccgatggtgcggccgctctcgtg
ctgatgcgtcgttccgaagccgaacgccggggattgaacgcgcttgcgacaatcagcggc
catgccacgcattcgcaggcgcccaatctctttgccaccgctccgatcggcgccttgcag
aagctctccgatcggatcggctggccgctcgataccgttgacctttttgagatcaatgaa
gcatttgccgttgtcgccatggctgccatgcgcgacctgaggctgccggacgaaaaggtc
aatgtgcatggcggggcctgcgcccttgggcacccgatcggtgcgtctggcgcacgtatt
ctcgtcacgctgcttgcggctctcgagcgctatgagctgaagcgcggcatggctgcccta
tgcatcggcggtggcgaggcaaccgccgttgcaatcgagcgtcattag

DBGET integrated database retrieval system