KEGG   Rhizobium sp. N1341: AMJ98_CH00572Help
Entry
AMJ98_CH00572     CDS       T04420                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00071  Fatty acid degradation
rhn00072  Synthesis and degradation of ketone bodies
rhn00280  Valine, leucine and isoleucine degradation
rhn00310  Lysine degradation
rhn00362  Benzoate degradation
rhn00380  Tryptophan metabolism
rhn00620  Pyruvate metabolism
rhn00630  Glyoxylate and dicarboxylate metabolism
rhn00640  Propanoate metabolism
rhn00650  Butanoate metabolism
rhn00900  Terpenoid backbone biosynthesis
rhn01100  Metabolic pathways
rhn01110  Biosynthesis of secondary metabolites
rhn01120  Microbial metabolism in diverse environments
rhn01130  Biosynthesis of antibiotics
rhn01200  Carbon metabolism
rhn01212  Fatty acid metabolism
rhn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMJ98_CH00572 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    AMJ98_CH00572 (fadA)
   00640 Propanoate metabolism
    AMJ98_CH00572 (fadA)
   00650 Butanoate metabolism
    AMJ98_CH00572 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    AMJ98_CH00572 (fadA)
   00072 Synthesis and degradation of ketone bodies
    AMJ98_CH00572 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMJ98_CH00572 (fadA)
   00310 Lysine degradation
    AMJ98_CH00572 (fadA)
   00380 Tryptophan metabolism
    AMJ98_CH00572 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMJ98_CH00572 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMJ98_CH00572 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMJ98_CH00572 (fadA)
Enzymes [BR:rhn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMJ98_CH00572 (fadA)
Exosome [BR:rhn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMJ98_CH00572 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ANL08295
Position
580342..581550
Genome map
AA seq 402 aa AA seqDB search
MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGLDTKTVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFASGKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSRTDVDAYAVESQKRAAHA
WEQGWFDKSVVPVKDQNGLTILDKDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAGAVLLGSKAGGESMGLKPRARIKAFANIGSDPALMLT
GPVDVTEKLLKRTGMRLSDIDLFELNEAFAAVVLRYMQAFDIDHDRINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggttttcatttacgaccacgtccgcacgccgcgcggccgcggcaagaaggac
ggcgccctgcatgaggtgccctccgtccgtctggcggcgaagacgctggaagcgatccgc
gaccgcaacgggctcgacaccaaaaccgttgacgacatcatcatgggctgcgtcgacccg
gtcatggatgccggcgccgtcatcccgaaggccgccgccttcgaagccggttattccacc
cgtgcgcccggcatgcagatctctcgcttctgcgcctccggcctcgatgccgtcaatttc
gcctccggcaagatcgcccaaggcgccgacgacatcgtcatagctggtggtgtggaaagc
atgtcgcgtgtcggcttgggcatgtcgggaggcgcctggttcatggatccgtcggtgaat
ttcccggcctatttcatgccgcagggcgtctcggccgatctcatcgccaccaaatacggt
ttcagccggaccgatgtcgacgcttacgccgtcgagagccagaagcgcgccgcccatgcc
tgggagcagggctggttcgacaagtcggtcgttccggtcaaggatcagaacggcctgacg
atcctcgataaggacgagcacatgcgtcccggcaccgatatgcaggcgctcgcctccctc
aacccgtccttccagatgcccggcgagatgggcggcttcgaggccgtcggcatccaggct
catcccgagatcgaacggatcaactatgtccaccacgccggcaattcctccggcatcgtc
gatggcgccggcgccgtgctgctcggctccaaagccggcggtgaaagcatggggttgaag
ccgcgcgcccgcatcaaggctttcgccaatatcggctccgatccggctttgatgctgacc
gggccggtcgacgtcaccgagaagctgttgaaacggaccggcatgcgcctgtcggatatc
gacctcttcgagctgaacgaagccttcgccgccgtcgtgctgcgctacatgcaggccttc
gacatcgaccacgacaggatcaacgttaatggcggcgccatcgccatgggccatccgctc
ggcgccaccggcgccatgatcctcggcaccgtgctcgacgagctggaacgtcgtgacctc
aacaccgcgctggtaacgctctgcatcggcgccggcatgggcacggcaaccgttatcgaa
cgcgtttga

DBGET integrated database retrieval system