KEGG   Roseburia hominis: RHOM_00305Help
Entry
RHOM_00305        CDS       T01621                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
rho  Roseburia hominis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rho01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rho00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rho00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rho00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rho00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rho00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:rho00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71296..73647)
Genome map
AA seq 783 aa AA seqDB search
MEKQKIMYDSGNELAAFAAKQINYHVMGYYPITPSTQIAENLDVMGAEGLHDIALIAAEG
EHSAAGICYGASAAGGRVFNATSANGLLYALEQFPVQSGTRMPMVMNVACRTVSGPLCIK
GDHSDVMYLLNTGWIILFADEPQKVYDFNLLGLKLAEAVRLPVAVAFDGFFTSHQKRKCL
VFENDDTVTRYIGEKLSCDNPKVSAFAGTGTCGTAAELPYASVLDLAHPVSIGSYMNEPD
VINNRYQLHLAMEAARNKLPELFTEYAALSGRELSLCGAYRHEDAEVLLFVLGSSYHTAM
EAVDRLRQDGVAAGVITLYVLRPFPAKELRVLCHNAFTILVADRQDSYGAGGGNMSLELK
AALSSLPHPPRILSRIYGLGGKDFFVEDALALFKEALSPDAPAFDYYGVTAGTEASDEET
SGTSGRADPAMAVSAMQPQYFKPVTKEESTPGLTTCTFDPTTGEMKVSGGSVKDTTAMPM
RVAPGHGACPGCGIPINVNLLLKGIEGNVVLLFQTGCGMVVTTGYPKTAFRVPFLHNLFQ
NGAATLSGVVEAFHQRQKRGEYPDGEITFVMVSGDGGMDIGMGSALGTALRGHKLIIFEY
DNGGYMNTGYQLSYSTPLGAKSSTSHVGKTQYGKNFFHKDTPELMAATHIPYVATVAESN
PTDFIRKAAKAAAYSREFGTAYIKALSACPLNWNDKPNLERSVIAAAVDCCYFPLYEIER
GITALNYDPASSNKKIPVTEWLGMMGRTRHLLKEEYRSVAEEIQKEIDRRYARLRARAEH
PLL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaaaaaattatgtatgacagcggcaatgagcttgctgcatttgccgcaaag
cagatcaactatcacgtcatggggtattatccgatcacgccctctacacagattgcggaa
aatctggatgtcatgggcgcggaggggcttcacgacattgccctgatcgccgccgaggga
gaacacagcgccgccggcatctgctacggcgcctcagccgctggaggccgtgtatttaat
gccaccagcgccaacgggcttttgtacgccttagaacagtttccggtgcagtccggcaca
cgcatgccgatggtcatgaatgttgcatgccgcacggtttccggccctttgtgcatcaaa
ggcgatcacagcgacgtcatgtatctgctcaacaccggctggatcattctttttgccgat
gaaccgcagaaagtctatgattttaacctgctcggtctaaagcttgccgaggctgtccgt
ctcccggtcgcagtcgcgttcgacggcttttttacgagccatcagaagcgcaagtgcctt
gtatttgagaatgatgacaccgtcacccgctatatcggggaaaagctttcctgtgacaac
ccgaaggtctccgcatttgccggcaccggcacctgcggcaccgccgcagagcttccctac
gccagcgtcttagatctcgcgcatccggtttccatcggttcctatatgaacgagccggat
gtcatcaataaccgctaccagctccatctcgccatggaagccgcgagaaacaagctgccg
gagctgtttacggaatatgctgccctctccggcagggaactttccctctgcggtgcctac
cggcacgaggacgccgaggtgctgctctttgtgctcggttcctcctaccacaccgccatg
gaagccgtcgaccggctgcggcaggacggcgtagcggcaggcgtgatcaccctctacgtt
ctgcgcccgttccccgctaaggaacttcgcgtcctctgccacaatgctttcacgattctt
gttgcagaccggcaggacagctacggcgccgggggcggcaacatgtcgcttgaattaaag
gccgctctctcttccctgccgcacccgccgcgcattttaagccggatctacggtctcggc
ggcaaggactttttcgtggaggacgcccttgccctctttaaagaggcactctcgccggac
gctccggcgttcgattactacggcgtcactgcgggcacggaagcttcggatgaggagact
tcaggcacttccggcagagctgacccggcgatggcggtttctgcgatgcagccgcaatat
tttaagcctgtcacaaaggaagaatccacaccgggtcttaccacctgcaccttcgatccc
acaaccggggaaatgaaagtctccggcggctccgtaaaagatacgaccgccatgccgatg
cgcgtcgcaccgggacacggtgcctgcccgggctgcggcattccgatcaatgtgaacctc
ctgttaaagggcatcgagggaaatgtcgtcctgctgtttcagaccggctgcggcatggta
gtgacaaccggctaccccaaaaccgcgttccgcgttccatttctgcacaatctgtttcag
aacggcgcggcgaccctaagcggcgttgtggaggcgtttcaccagcgccagaagcgcggg
gaatatccggacggcgagattacctttgtgatggtgagcggtgacggcggcatggatatc
ggtatgggatcggcactcggcaccgccctgcgcggtcataagctgatcatttttgagtac
gataacggcggctacatgaataccggctaccagctctcctactccacaccgctcggcgca
aagagttctacttcccatgtcggaaagacgcagtacggcaagaacttcttccacaaggac
acaccggagctgatggccgcaacccacattccctatgtcgccacggtcgcagaatcgaat
ccgaccgattttatccggaaagcggcaaaagccgccgcctattccagggagtttggcact
gcctatatcaaggcgctgtccgcctgtccgttaaactggaatgataagcccaatctggag
cggagcgtcattgctgccgccgtagactgctgttattttccgctctacgaaattgagcgt
ggtatcacagcgctgaattatgatcctgcttcgagcaataagaaaatccctgtcacagaa
tggctgggtatgatgggacgcaccaggcatctgctgaaggaggagtaccgctccgtggcc
gaagagatccaaaaagagatcgaccggcgctacgcccgtcttagagcgcgtgccgagcat
ccgcttctgtag

DBGET integrated database retrieval system