KEGG   Roseburia hominis: RHOM_00305Help
Entry
RHOM_00305        CDS       T01621                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
rho  Roseburia hominis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHOM_00305
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHOM_00305
   00020 Citrate cycle (TCA cycle)
    RHOM_00305
   00620 Pyruvate metabolism
    RHOM_00305
   00640 Propanoate metabolism
    RHOM_00305
   00650 Butanoate metabolism
    RHOM_00305
  Energy metabolism
   00680 Methane metabolism
    RHOM_00305
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RHOM_00305
Enzymes [BR:rho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     RHOM_00305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71296..73647)
Genome map
AA seq 783 aa AA seqDB search
MEKQKIMYDSGNELAAFAAKQINYHVMGYYPITPSTQIAENLDVMGAEGLHDIALIAAEG
EHSAAGICYGASAAGGRVFNATSANGLLYALEQFPVQSGTRMPMVMNVACRTVSGPLCIK
GDHSDVMYLLNTGWIILFADEPQKVYDFNLLGLKLAEAVRLPVAVAFDGFFTSHQKRKCL
VFENDDTVTRYIGEKLSCDNPKVSAFAGTGTCGTAAELPYASVLDLAHPVSIGSYMNEPD
VINNRYQLHLAMEAARNKLPELFTEYAALSGRELSLCGAYRHEDAEVLLFVLGSSYHTAM
EAVDRLRQDGVAAGVITLYVLRPFPAKELRVLCHNAFTILVADRQDSYGAGGGNMSLELK
AALSSLPHPPRILSRIYGLGGKDFFVEDALALFKEALSPDAPAFDYYGVTAGTEASDEET
SGTSGRADPAMAVSAMQPQYFKPVTKEESTPGLTTCTFDPTTGEMKVSGGSVKDTTAMPM
RVAPGHGACPGCGIPINVNLLLKGIEGNVVLLFQTGCGMVVTTGYPKTAFRVPFLHNLFQ
NGAATLSGVVEAFHQRQKRGEYPDGEITFVMVSGDGGMDIGMGSALGTALRGHKLIIFEY
DNGGYMNTGYQLSYSTPLGAKSSTSHVGKTQYGKNFFHKDTPELMAATHIPYVATVAESN
PTDFIRKAAKAAAYSREFGTAYIKALSACPLNWNDKPNLERSVIAAAVDCCYFPLYEIER
GITALNYDPASSNKKIPVTEWLGMMGRTRHLLKEEYRSVAEEIQKEIDRRYARLRARAEH
PLL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaaaaaattatgtatgacagcggcaatgagcttgctgcatttgccgcaaag
cagatcaactatcacgtcatggggtattatccgatcacgccctctacacagattgcggaa
aatctggatgtcatgggcgcggaggggcttcacgacattgccctgatcgccgccgaggga
gaacacagcgccgccggcatctgctacggcgcctcagccgctggaggccgtgtatttaat
gccaccagcgccaacgggcttttgtacgccttagaacagtttccggtgcagtccggcaca
cgcatgccgatggtcatgaatgttgcatgccgcacggtttccggccctttgtgcatcaaa
ggcgatcacagcgacgtcatgtatctgctcaacaccggctggatcattctttttgccgat
gaaccgcagaaagtctatgattttaacctgctcggtctaaagcttgccgaggctgtccgt
ctcccggtcgcagtcgcgttcgacggcttttttacgagccatcagaagcgcaagtgcctt
gtatttgagaatgatgacaccgtcacccgctatatcggggaaaagctttcctgtgacaac
ccgaaggtctccgcatttgccggcaccggcacctgcggcaccgccgcagagcttccctac
gccagcgtcttagatctcgcgcatccggtttccatcggttcctatatgaacgagccggat
gtcatcaataaccgctaccagctccatctcgccatggaagccgcgagaaacaagctgccg
gagctgtttacggaatatgctgccctctccggcagggaactttccctctgcggtgcctac
cggcacgaggacgccgaggtgctgctctttgtgctcggttcctcctaccacaccgccatg
gaagccgtcgaccggctgcggcaggacggcgtagcggcaggcgtgatcaccctctacgtt
ctgcgcccgttccccgctaaggaacttcgcgtcctctgccacaatgctttcacgattctt
gttgcagaccggcaggacagctacggcgccgggggcggcaacatgtcgcttgaattaaag
gccgctctctcttccctgccgcacccgccgcgcattttaagccggatctacggtctcggc
ggcaaggactttttcgtggaggacgcccttgccctctttaaagaggcactctcgccggac
gctccggcgttcgattactacggcgtcactgcgggcacggaagcttcggatgaggagact
tcaggcacttccggcagagctgacccggcgatggcggtttctgcgatgcagccgcaatat
tttaagcctgtcacaaaggaagaatccacaccgggtcttaccacctgcaccttcgatccc
acaaccggggaaatgaaagtctccggcggctccgtaaaagatacgaccgccatgccgatg
cgcgtcgcaccgggacacggtgcctgcccgggctgcggcattccgatcaatgtgaacctc
ctgttaaagggcatcgagggaaatgtcgtcctgctgtttcagaccggctgcggcatggta
gtgacaaccggctaccccaaaaccgcgttccgcgttccatttctgcacaatctgtttcag
aacggcgcggcgaccctaagcggcgttgtggaggcgtttcaccagcgccagaagcgcggg
gaatatccggacggcgagattacctttgtgatggtgagcggtgacggcggcatggatatc
ggtatgggatcggcactcggcaccgccctgcgcggtcataagctgatcatttttgagtac
gataacggcggctacatgaataccggctaccagctctcctactccacaccgctcggcgca
aagagttctacttcccatgtcggaaagacgcagtacggcaagaacttcttccacaaggac
acaccggagctgatggccgcaacccacattccctatgtcgccacggtcgcagaatcgaat
ccgaccgattttatccggaaagcggcaaaagccgccgcctattccagggagtttggcact
gcctatatcaaggcgctgtccgcctgtccgttaaactggaatgataagcccaatctggag
cggagcgtcattgctgccgccgtagactgctgttattttccgctctacgaaattgagcgt
ggtatcacagcgctgaattatgatcctgcttcgagcaataagaaaatccctgtcacagaa
tggctgggtatgatgggacgcaccaggcatctgctgaaggaggagtaccgctccgtggcc
gaagagatccaaaaagagatcgaccggcgctacgcccgtcttagagcgcgtgccgagcat
ccgcttctgtag

DBGET integrated database retrieval system