KEGG   Roseburia hominis: RHOM_00360Help
Entry
RHOM_00360        CDS       T01621                                 

Definition
(GenBank) lysophospholipase L2 PLDB, hydrolase of alpha/beta superfamily protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
rho  Roseburia hominis
Pathway
rho00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RHOM_00360
Enzymes [BR:rho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RHOM_00360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH Peptidase_S28 Esterase LCAT Lipase_3 Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: AEN95199
UniProt: G2SZ41
Position
85204..86241
Genome map
AA seq 345 aa AA seqDB search
MPEDRSCAKEEKTAYAVWMAETVEPYLKEHGEKGYLKMEDGMSIAYRRYFLPDAGKCVVI
SHGFCEFAEKYNEVAYRFLQAGYSVYVPEHRGHGYSGREVDDPELVHVQSYDCYAADLAR
FVETVVSPGEEHRIVFAHSMGGAIAILALERYPQLFEAAVLSAPMCAMQTGKYPRFLAKL
LAEFCCLTGKGKCFATLAGQQGFSETPQFEGSSCLSKERYDYMFQKRLLDEHYRTYGGSY
AWVRAGLRASRKLMRRENLAKIKVPVLLFAAGRDHMVDNDAIARFAEETERTKLFFMPDS
RHEIFNADERTRAKYYDEIFRFIKEEEVKDYENENEQTRKILGTV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggatagaagctgtgcgaaagaggagaagactgcttatgccgtctggatggcg
gagacggtagagccttatctgaaagagcacggcgagaagggctatcttaagatggaagat
ggcatgtcgatcgcttaccggcgctattttctgccggatgcggggaaatgtgttgtgatt
tcccacgggttttgcgaattcgcggaaaaatataacgaagtcgcataccgttttctgcag
gcgggatactcggtctatgtgccggaacaccggggacacgggtattccgggcgcgaggtg
gatgacccggaactggtgcatgtgcaaagttatgactgctatgccgcagatctcgcgcgg
tttgtggagacggtcgtaagtcccggggaggaacaccggatcgtgtttgcacattcgatg
ggaggcgccattgcaatccttgcactggaacgttatccgcagttgtttgaggcggcagtc
ctctccgcgccgatgtgtgccatgcagaccggaaaatatccgcggtttctggcaaaactg
ctggcggagttctgctgtctgaccggaaaaggaaaatgctttgccacactggcgggacag
cagggcttttcagagacgccgcagtttgaggggagcagctgcctttcaaaagagcgttat
gactatatgtttcaaaagcggctcttagatgaacattaccgcacctacggcggaagttat
gcctgggtccgcgcagggcttcgcgccagccgtaagctgatgcggcgggagaatctggca
aagatcaaggtgccggtgctgctttttgcagcaggtcgtgaccacatggtggataacgat
gcgatcgcgcggtttgcggaggagacggagcggacaaagcttttctttatgccggattcc
agacatgagatttttaatgcggatgagcggacgcgtgcgaaatattatgatgaaatattc
cgctttattaaggaagaagaggtaaaagattatgaaaacgaaaatgagcagactcgaaaa
attctgggtactgtatga

DBGET integrated database retrieval system