KEGG   Roseburia hominis: RHOM_01315Help
Entry
RHOM_01315        CDS       T01621                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rho  Roseburia hominis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RHOM_01315
Enzymes [BR:rho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RHOM_01315
Exosome [BR:rho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHOM_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(299802..301298)
Genome map
AA seq 498 aa AA seqDB search
MAKYIMALDAGTTSNRCILFNEKGEMCSVAQKEFTQYFPKPGWVEHDAEEIWSTQLEVAK
EAMANVGATAADIGAIGITNQRETTIVWDKNTGEPIHHAIVWQCRRTSEYCDSLKAKGLV
DTFRQKTGLVIDAYFSGTKLKWLLDNVEGARERAERGELLFGTVETWLIWKLTQGQVHVT
DYSNASRTLMFNINTLEWDEDILKELNIPKCMLPEPKPSSCVYGEANPVFFGGPIPIAGA
AGDQQAALFGQTCFTAGEAKNTYGTGCFLLMNTGEKPVFSKNGLVTTIAWGLDGKVNYAL
EGSIFVAGASIQWLRDEMRFIDSSPDSEYMARKVKDTNGCYVVPAFTGLGAPYWDQYARG
TIVGITRGVNKYHIIRATLESLAYQVNDVLAAMKADSGIDLAALKVDGGASANNLLMQMQ
ADISNAPVNRPMCVETTAMGAAYLAGLAVGYWASKEDVLQNWAIDRTFTPEITDEERNKK
VRMWKKAVTYSFNWAKED
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacatcatggcactcgatgccggaaccaccagcaaccgctgcatacttttc
aatgagaagggtgaaatgtgcagcgttgcccagaaagaatttacacagtatttcccgaag
ccgggctgggtagagcacgacgcggaggagatctggtccacacagcttgaagttgccaag
gaggcaatggcaaatgtgggcgcgactgcagccgatatcggggcaatcggaattaccaat
cagcgcgagaccaccatcgtatgggataagaacaccggcgaaccgattcatcacgcgatc
gtatggcagtgccgccgtacttccgaatactgcgattccttaaaagccaagggactggtt
gataccttccgccagaagacaggactggtgatcgacgcctacttctccggaacgaaatta
aaatggctgctcgacaacgttgaaggcgccagagagagagccgagagaggcgagctgctc
ttcggaaccgtggagacatggctgatctggaaactgacacagggtcaggttcacgtaact
gattactccaacgcttccagaaccttgatgttcaacatcaataccctggagtgggatgaa
gatattttaaaagaactgaatattccaaaatgtatgctgccggaaccgaagccatccagc
tgcgtgtacggcgaagcaaacccggtattcttcggaggcccgattccgattgccggtgct
gccggtgaccaacaggccgctctgttcggtcagacctgttttaccgccggtgaggcaaaa
aatacttacggaaccggctgtttcttacttatgaacaccggcgaaaaacctgtattctcc
aagaacggactggttaccacgatcgcatggggtctcgacggaaaagtaaactacgcactc
gagggttccatcttcgttgcaggtgcctccatccagtggcttcgcgatgagatgcgcttc
atcgattcctctccggattccgaatacatggcaagaaaagtcaaagacaccaacggctgc
tacgtcgtgcctgctttcaccggtcttggtgccccgtactgggatcaatacgcacgtgga
actatcgtaggcattacccgcggtgtgaataaataccatattatccgtgcaaccttagag
tctctcgcttaccaggttaatgatgtattggctgcaatgaaagcagattccggtattgat
cttgcagcattaaaggtagacggcggagcaagcgcaaacaatctgctcatgcagatgcag
gcggacatcagcaatgctccggtcaaccgtccgatgtgcgtggagaccacagccatgggt
gctgcctatctcgccggactggcagtcggctactgggcaagcaaagaggatgttcttcag
aactgggcaatcgaccgcaccttcacaccggagatcaccgacgaggagcgtaacaagaaa
gtccgcatgtggaagaaagccgttacttattcgttcaactgggcgaaggaagactaa

DBGET integrated database retrieval system