KEGG   Roseburia hominis: RHOM_01585Help
Entry
RHOM_01585        CDS       T01621                                 

Definition
Type III site-specific deoxyribonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
rho  Roseburia hominis
Brite
Enzymes [BR:rho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     RHOM_01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(349052..352207)
Genome map
AA seq 1051 aa AA seqDB search
MKLKFKNQAFQMDAVNAVVDLFAGQEKTRSTFSVMEEAQTNFLNELGQGNALYIDQETLT
ANMHTVQKRNNLPLTPTAEGCQFCIEMETGTGKTYVYTKTIFELNRKYGFTKFVIVVPSV
AIREGVYKSFQVTQEHFGLQYDNVPCRYFIYNSAKLSDVRQFATSSNIEVMIINIDAFKK
AENIINQAQDRLNGETAMGFIQNTHPIVIIDEPQSVDNTPKAKEAIATLNPLCVLRYSAT
HREKINLLYRLTPVDAYQMGLVKQIAVSSNQVAGGFNQAYVRLLSVSNDKGFKARVELDV
KGKTGAVTRKAMTVKPGDDLFLLSGGRELYEGYTVTGIDCTPDFEHIEFGNTQEVKLGKA
IGDVDENIVKKAQIRRTIETHLDKELRYLDKGIKVLSLFFIDKVDKYRHEDGTPGIYATM
FEECYQELIAKPKYALLRERFTTDVSKVHNGYFSQDKKGRLKDTKGDTQADDDTYNTIMR
DKEWLLSFECPLRFIFSHSALREGWDNPNVFQVCTLIEQKSTFTCRQKVGRGLRLCVNQD
GERIEDKNINVLHVMANESFSEFASTLQKEIEDETGVKFGVLQLSLFAGMTYQEEVTREH
TIDREEAHELVKTWMDDGSIDKWMADPEMTAAEEKITAELESGKITEPPSPVTEVMRQIK
NGATAEQAAEAIIGITSTITTVEEHTVTHEEATELLEHFEQKGYITSTGKVKDTMKNALK
NGTLDLPKKYEAARERFEQIIANADRKPPVRDASRDVVVRLNKQVMLSPEFLELWSKIKQ
KTAYRVSIDTEQLVKNCVKAFQEMPHIPKTRLVSQTADIHIQQSGISHMEREMRTMEIAN
DYQALPDIITAISDETLLTPATVNRILVESGRCGDFLNNPEAFLEQAVELIRSHRHALAI
DGIRYVKLDGQEYYVQEIFDTTELLANLDRNAVKVEHSVYDYVVYDSSTVEKPVAVALDN
DPDVKMFFKIPSRFKIETPIGTYNPDWAVYLNKNGEEKLYFVLETKGDTSFMHLKTSEQL
KIHCGKEHFKALDAGVELETATSWTELRKRI
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaattcaagaatcaagccttccaaatggatgcagtcaacgctgtggtggat
ttgtttgccggccaggagaaaacacggagcaccttctccgtcatggaggaagcccagacc
aatttcttaaatgagctgggccagggcaatgctctctacattgaccaggaaacattgacc
gccaatatgcacaccgtccagaagcggaataacctgcccctgacccccacagcggaaggc
tgccagttctgtattgagatggaaactggcaccggcaagacctacgtctacaccaagacc
atctttgagctgaaccgcaagtacggattcaccaagtttgttatcgtggtgccgtcggtg
gccatccgggagggcgtctacaaatcctttcaggtcacgcaggagcatttcggcctgcaa
tacgacaacgtgccatgccggtacttcatctacaactctgccaagctgtccgacgtgcgg
caatttgccaccagttccaatatcgaagtgatgattattaacatcgacgctttcaagaaa
gcggagaacatcatcaatcaagcgcaggatcggctcaacggtgaaacggctatgggcttt
attcagaacacacaccctatcgttatcatcgatgaaccccagagcgtggacaacaccccc
aaggccaaggaagccattgccacgctcaatcccctgtgtgtgctgcggtactccgccacc
caccgagaaaaaatcaatctgctttaccgcctgactccggtagacgcctaccagatgggg
ctggtcaagcagatcgccgtatcctccaatcaggttgccggtggcttcaatcaagcctat
gtgcggctgctttccgtcagcaacgacaagggctttaaggccagagtggaactggatgtg
aagggcaagaccggagccgtgacccgcaaggccatgactgtcaagccgggcgacgattta
ttcctgctgtccggcgggcgggaactgtacgaaggctacaccgttaccggaattgactgc
actcccgattttgaacatatcgagtttggcaatacccaggaggtcaagctgggcaaggcc
attggagacgtggacgagaacatcgtcaagaaggcgcaaatccggcgcaccatcgaaacc
caccttgacaaagagctgcggtatctggacaaggggatcaaggtactgtccctgttcttc
atcgataaggtggacaagtaccgccacgaggacggcacacccggcatctacgccactatg
tttgaggagtgctatcaggagctgatcgcaaagcccaagtatgcgctcctccgagagcga
ttcaccacagatgtgagcaaggtacataacggctacttctctcaggacaagaaaggacgc
ctgaaggacaccaagggcgacacccaggccgacgatgacacctacaacaccatcatgcgg
gacaaggagtggcttctcagctttgagtgtccgctgcggtttattttctcccactcggcg
ctgcgggaaggctgggacaaccccaacgtgtttcaggtctgcaccctgatcgagcagaag
tccacctttacctgccgccagaaggtgggccgtggcctgcgcctgtgcgtgaaccaggac
ggtgaacgcatcgaggacaagaatatcaatgtccttcacgtcatggccaacgagagcttt
tccgagtttgcttccaccctccagaaagagatcgaggacgaaactggcgtcaagtttggt
gtactccagctcagtttgtttgctgggatgacctatcaggaagaagttacccgtgagcat
acgattgacagagaagaggcccacgagctggtaaaaacctggatggacgacggctccatt
gacaaatggatggccgaccccgaaatgacggcagcggaagaaaaaattacagcggaattg
gaatcagggaaaatcaccgaaccgcccagccccgtaacggaagtcatgcgccaaattaaa
aacggtgcgaccgctgaacaggcagcagaggcaattattggaatcaccagtacaatcact
accgtagaggaacataccgtcacccacgaggaagctacggagctgctggagcattttgag
cagaaggggtatatcaccagcaccggtaaggtcaaggataccatgaagaacgctttgaag
aacggaacccttgacctgccgaaaaaatatgaagctgccagagagcgttttgagcagatt
atcgccaatgccgaccggaagcccccggtgcgggatgcctcccgtgatgtggtggtacgg
ctcaacaaacaggtcatgctctccccggagttcctggagctgtggagcaagatcaagcag
aaaaccgcctaccgggtgagcattgacacagagcagctggtgaagaactgcgtcaaagcc
tttcaggaaatgccccatatccccaaaacccgtctggtgtcccagactgccgatattcac
atccagcagtccgggatcagccacatggaacgggaaatgcggacgatggagattgccaac
gattatcaggccctgccggacatcatcaccgccatcagcgatgaaacgctgttgaccccg
gctaccgtcaatcggattctggtagagagcggacggtgtggcgatttcctcaacaatccg
gaggcatttctggagcaagccgtagagctaatccgcagccaccgccacgccttggctatc
gacggtatccgttatgtgaagctggatggccaggaatattatgtgcaggaaatcttcgac
accacggagttgcttgctaacctggatcgaaacgccgtaaaggtggaacacagcgtctat
gactatgtggtttacgacagctccacggtagagaagccggtggcggtggccctggacaac
gacccggatgtgaagatgttcttcaagattcccagccgcttcaaaattgaaacccccatt
ggcacgtacaaccccgactgggctgtgtatctgaataagaacggtgaggaaaagctgtac
ttcgtcctggaaaccaagggtgacaccagctttatgcacctgaaaaccagtgagcagcta
aaaatccactgcggcaaggagcatttcaaagcactggacgcaggtgtggagctggagact
gcaaccagttggacggagctgcgcaagcgcatttga

DBGET integrated database retrieval system