KEGG   Roseburia hominis: RHOM_02130Help
Entry
RHOM_02130        CDS       T01621                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rho  Roseburia hominis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RHOM_02130
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RHOM_02130
Enzymes [BR:rho01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RHOM_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
465856..466020
Genome map
AA seq 54 aa AA seqDB search
MGIMLRKIDKNYKENPDIKWNFTKFLVDRQGTVVVRFEPTGDMNELERQILALL
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgggaataatgctccgcaaaatagataagaattataaggagaatcccgacatcaaatgg
aattttacgaagttccttgtggacaggcagggcacggtagtggtaagatttgaaccaaca
ggagatatgaacgaactggaacgacagattcttgcattattatag

DBGET integrated database retrieval system