KEGG   Roseburia hominis: RHOM_03615Help
Entry
RHOM_03615        CDS       T01621                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rho  Roseburia hominis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rho01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rho01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rho00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rho00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rho00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rho00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rho00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
789611..790585
Genome map
AA seq 324 aa AA seqDB search
MAKEINTIGVLTSGGDAPGMNAAIRAVVREAIAKGKKVKGIKRGYAGLLQEEIVDMEAKD
VSDIIQRGGTILQTARCMEFKTPEGQQRAAEICKKHGIDGIIVIGGDGSFRGAQKLAALG
INTIGLPGTIDLDIACTEYTIGFDTAVNTAMEAIDKVRDTSTSHERCSIIEVMGRGAGYI
ALWCGIANGAEDILLPEKYDYDEQKIVNHIIENRKRGKQHHIIVNAEGIGHSASMAKRIE
AATGVETRATILGHMQRGGSPTCKDRVYASTMGALAVDLLCEGKSNRVVGYRHGDFVDDD
IDAALAMQKCIPEYQYQISKNLSM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagagataaacaccattggtgtactcacgagcggcggcgatgccccgggtatg
aacgcagcaatccgtgcagtggttagggaagccattgccaagggtaagaaagtcaaggga
atcaagagaggttatgcaggacttcttcaggaagagattgtggatatggaagcaaaagac
gtttccgatatcatccagcgcggtggtactattttacagacagcacgctgcatggagttc
aagacaccggaaggtcagcagagagcagcagagatctgcaagaagcatggaatcgacgga
attatcgttatcggcggtgacggatctttcagaggtgcgcagaagctggcggcactcggt
atcaacacgatcggtcttccgggaacgattgaccttgatattgcatgtacagagtatacc
atcggttttgatacagcggtgaacaccgcaatggaagcgatcgacaaggtacgtgatacc
tctacttctcatgagcgctgcagcatcatcgaggttatgggtcgcggtgcaggttatatt
gcattatggtgcggtattgcgaacggcgcagaggatattctgcttccggagaagtatgat
tacgatgagcagaagattgtaaaccatatcatcgagaaccgtaaacgcggcaaacagcat
cacattattgtcaatgctgagggtatcggacattctgcaagtatggcgaagcgtatcgag
gctgcaaccggcgttgagacgcgtgcgacgattctgggtcacatgcagcgtggaggaagc
ccgacctgtaaggatcgtgtctatgcatccacgatgggtgcgctggcagtggatctgctc
tgcgagggcaagagcaaccgtgtcgttggttatcgtcacggcgatttcgtggatgacgac
atcgatgcggcacttgcaatgcagaaatgcattccggagtatcagtatcagatcagcaag
aatctttcaatgtaa

DBGET integrated database retrieval system