KEGG   Roseburia hominis: RHOM_03780Help
Entry
RHOM_03780        CDS       T01621                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rho  Roseburia hominis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rho00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rho00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
819828..821615
Genome map
AA seq 595 aa AA seqDB search
MVDMKAKPFYLSDEDCKWVEETIAGMTTEEKIGQLFFNMGSSRDEEYLKMTVDKYHIGGI
RYNPATGAEVREQNRILQENSKIPLIIACNTENGGNGACTDGTMIGQQTKIGATRDARYA
YELGRMSNKEAAAIGCNLSFAPVSDILYNWENPVIGLRTYGNDVDRVCEMTKAYMDGAHT
NEGFCCAAKHFPGDGLDFRDQHVADSVNDMSCEEWDASYGKVYQNLIDNGLEAIMAGHIM
QPAYTRHFNPGIRDEDIMPATLSPELIEGLLRGKLGFNGMVLTDASHMVGLTCCMKRSEM
LPHTIAAGVDMFLFFNEMDEDFASMMAGYENGIITEERLNDALHRILALKAHMGLHKKAK
NEIVPPVEVMEQVVGCEEHKAMAREISEKGITLVKYKDEDVLPMIPSRYKRIMIVSVSGL
SAGVMGTMMAKYMGGGKKSPAERLRDKLIEKGFEAFIYESPLDALAKRAAAGEKVDINMY
FAGKTPIKDFVENQDLIITLVDIAGGFQPVARPGFGMSKGGGEIPWYVHELPVIVIGCGQ
PFVLADIPQARTYINTYDSADQTFDALIEKLMSGSDAFIGEDPVDAYCGLWDTHR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtagatatgaaggcaaaaccgttttacctgtccgatgaggactgtaaatgggtggaa
gagaccatcgcgggtatgacgaccgaggagaagatcggtcagctttttttcaatatggga
tcctccagagacgaagagtatctgaagatgacagtggacaagtaccacatcggcggtatc
cgctacaacccggcaaccggtgccgaggtgcgtgagcagaaccggattcttcaggagaac
agcaagattccgcttatcattgcgtgcaacacggagaatggcggcaacggcgcctgcact
gacggaaccatgatcggccagcagaccaagatcggtgcgacaagagacgccagatacgcg
tacgagctcggccgtatgtccaacaaagaggcggcggcgatcgggtgtaatctctccttt
gccccggtcagcgacatcctctacaactgggagaacccggtcatcggactgcgcacctat
ggaaacgatgtggaccgcgtgtgcgagatgacgaaggcatatatggacggcgcacacacc
aatgagggattctgctgtgctgcgaagcattttccgggcgacggactggacttccgcgac
cagcacgtggcagacagcgtcaatgacatgagctgtgaggagtgggatgcaagctatgga
aaagtataccagaacctcattgacaacggtctggaagccatcatggcaggacacattatg
cagcctgcgtacaccagacattttaacccgggaatcagggatgaggacatcatgccggca
accctttcgccggagctgatcgagggacttctgcgcggaaagcttggttttaatggtatg
gtgctgaccgatgcttcccacatggtcggactgacctgctgtatgaagcgcagcgagatg
cttccgcacacgattgcagccggtgtcgatatgttcctttttttcaatgagatggatgag
gattttgcaagcatgatggcgggctatgagaacggcatcatcaccgaggagcgtttaaat
gacgccctgcaccgcattcttgctctgaaagcacacatgggactgcacaaaaaagcgaaa
aatgagatcgttcctccggtggaggtgatggagcaggtcgttggctgcgaagagcacaag
gcgatggcaagagaaatctccgagaaaggaatcactctcgtaaaatacaaggacgaggat
gtgcttccgatgatcccgagccgttacaagcgcatcatgatcgtctccgtcagcggatta
tccgcgggcgtgatgggaaccatgatggcaaaatatatgggcggcggcaagaagagcccg
gcagagcgtctgcgtgacaagctgatcgagaagggctttgaagcatttatctacgagagc
ccgctcgacgcacttgcaaagcgtgcagcagcaggagaaaaggtggacatcaatatgtac
tttgccggaaagacgccgatcaaggatttcgtcgaaaatcaggatctgatcatcacactg
gtggacattgcaggcggtttccagccggtggcaagaccgggcttcggcatgagcaagggc
ggcggagagatcccgtggtatgttcatgaacttccggttatcgtgatcggatgcggacag
ccgttcgtactggcagacattccgcaggcgagaacgtatatcaacacttacgacagcgcg
gatcagacgtttgatgcgctcatcgagaagctgatgagcggcagcgacgcatttatcggg
gaggacccggtggatgcctactgcggactgtgggatacgcaccggtag

DBGET integrated database retrieval system