KEGG   Roseburia hominis: RHOM_03780Help
Entry
RHOM_03780        CDS       T01621                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rho  Roseburia hominis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHOM_03780
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RHOM_03780
Enzymes [BR:rho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHOM_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
819828..821615
Genome map
AA seq 595 aa AA seqDB search
MVDMKAKPFYLSDEDCKWVEETIAGMTTEEKIGQLFFNMGSSRDEEYLKMTVDKYHIGGI
RYNPATGAEVREQNRILQENSKIPLIIACNTENGGNGACTDGTMIGQQTKIGATRDARYA
YELGRMSNKEAAAIGCNLSFAPVSDILYNWENPVIGLRTYGNDVDRVCEMTKAYMDGAHT
NEGFCCAAKHFPGDGLDFRDQHVADSVNDMSCEEWDASYGKVYQNLIDNGLEAIMAGHIM
QPAYTRHFNPGIRDEDIMPATLSPELIEGLLRGKLGFNGMVLTDASHMVGLTCCMKRSEM
LPHTIAAGVDMFLFFNEMDEDFASMMAGYENGIITEERLNDALHRILALKAHMGLHKKAK
NEIVPPVEVMEQVVGCEEHKAMAREISEKGITLVKYKDEDVLPMIPSRYKRIMIVSVSGL
SAGVMGTMMAKYMGGGKKSPAERLRDKLIEKGFEAFIYESPLDALAKRAAAGEKVDINMY
FAGKTPIKDFVENQDLIITLVDIAGGFQPVARPGFGMSKGGGEIPWYVHELPVIVIGCGQ
PFVLADIPQARTYINTYDSADQTFDALIEKLMSGSDAFIGEDPVDAYCGLWDTHR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtagatatgaaggcaaaaccgttttacctgtccgatgaggactgtaaatgggtggaa
gagaccatcgcgggtatgacgaccgaggagaagatcggtcagctttttttcaatatggga
tcctccagagacgaagagtatctgaagatgacagtggacaagtaccacatcggcggtatc
cgctacaacccggcaaccggtgccgaggtgcgtgagcagaaccggattcttcaggagaac
agcaagattccgcttatcattgcgtgcaacacggagaatggcggcaacggcgcctgcact
gacggaaccatgatcggccagcagaccaagatcggtgcgacaagagacgccagatacgcg
tacgagctcggccgtatgtccaacaaagaggcggcggcgatcgggtgtaatctctccttt
gccccggtcagcgacatcctctacaactgggagaacccggtcatcggactgcgcacctat
ggaaacgatgtggaccgcgtgtgcgagatgacgaaggcatatatggacggcgcacacacc
aatgagggattctgctgtgctgcgaagcattttccgggcgacggactggacttccgcgac
cagcacgtggcagacagcgtcaatgacatgagctgtgaggagtgggatgcaagctatgga
aaagtataccagaacctcattgacaacggtctggaagccatcatggcaggacacattatg
cagcctgcgtacaccagacattttaacccgggaatcagggatgaggacatcatgccggca
accctttcgccggagctgatcgagggacttctgcgcggaaagcttggttttaatggtatg
gtgctgaccgatgcttcccacatggtcggactgacctgctgtatgaagcgcagcgagatg
cttccgcacacgattgcagccggtgtcgatatgttcctttttttcaatgagatggatgag
gattttgcaagcatgatggcgggctatgagaacggcatcatcaccgaggagcgtttaaat
gacgccctgcaccgcattcttgctctgaaagcacacatgggactgcacaaaaaagcgaaa
aatgagatcgttcctccggtggaggtgatggagcaggtcgttggctgcgaagagcacaag
gcgatggcaagagaaatctccgagaaaggaatcactctcgtaaaatacaaggacgaggat
gtgcttccgatgatcccgagccgttacaagcgcatcatgatcgtctccgtcagcggatta
tccgcgggcgtgatgggaaccatgatggcaaaatatatgggcggcggcaagaagagcccg
gcagagcgtctgcgtgacaagctgatcgagaagggctttgaagcatttatctacgagagc
ccgctcgacgcacttgcaaagcgtgcagcagcaggagaaaaggtggacatcaatatgtac
tttgccggaaagacgccgatcaaggatttcgtcgaaaatcaggatctgatcatcacactg
gtggacattgcaggcggtttccagccggtggcaagaccgggcttcggcatgagcaagggc
ggcggagagatcccgtggtatgttcatgaacttccggttatcgtgatcggatgcggacag
ccgttcgtactggcagacattccgcaggcgagaacgtatatcaacacttacgacagcgcg
gatcagacgtttgatgcgctcatcgagaagctgatgagcggcagcgacgcatttatcggg
gaggacccggtggatgcctactgcggactgtgggatacgcaccggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system