KEGG   Roseburia hominis: RHOM_04600Help
Entry
RHOM_04600        CDS       T01621                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rho  Roseburia hominis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHOM_04600
Enzymes [BR:rho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RHOM_04600
Exosome [BR:rho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHOM_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
989684..990376
Genome map
AA seq 230 aa AA seqDB search
MTQRAIRHIKKRMPELLVIADVCLCEYTSHGHCGLVCEGEILNDETLPLLAKMSVSLVKA
GADVIAPSDMMDGRVAAIREALDENDCKNTMLMAYSAKFASGFYGPFREAAHSVPSFGDR
RTYQMDPANRREAIRECLSDIEEGADIIMVKPALAYLDVVREVMDRTDYPLAAYNVSGEY
AMVKAAAANGWIDERRIVMEIMTGIKRAGAKIIITYHALDVAKWLDEERK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagcgagcgatccgccacatcaagaaacggatgccggagcttctcgtgatcgcg
gatgtgtgtctgtgcgagtacacgtcccacggacactgtggccttgtgtgtgagggtgag
attttaaatgatgagacactgccgcttttggcaaaaatgtcggtaagtctcgtaaaggca
ggcgcggacgtgattgctccatccgatatgatggacggaagagtggcggcgatccgtgag
gctctggatgagaacgactgcaaaaataccatgctgatggcgtacagcgcaaagtttgca
tccggtttttacggaccgttccgcgaggcggcacattccgtgccgagctttggcgaccgc
agaacttaccagatggatccggcaaaccgcagggaagccatccgggaatgtctgtccgat
attgaggagggcgcagacatcattatggtaaagcctgcgcttgcgtatctggatgtcgta
agagaggtcatggaccgtacggattacccgctggcggcgtacaatgtgagcggggagtat
gcgatggtaaaggcggcagcggcaaacggctggattgatgagcggcggatcgtgatggag
atcatgaccggcatcaaacgcgcgggtgcgaaaatcatcatcacctatcacgcgctggat
gtggcaaagtggctggacgaggagagaaagtag

DBGET integrated database retrieval system