KEGG   Roseburia hominis: RHOM_04745Help
Entry
RHOM_04745        CDS       T01621                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rho  Roseburia hominis
Pathway
rho00010  Glycolysis / Gluconeogenesis
rho00030  Pentose phosphate pathway
rho00051  Fructose and mannose metabolism
rho00052  Galactose metabolism
rho00680  Methane metabolism
rho01100  Metabolic pathways
rho01110  Biosynthesis of secondary metabolites
rho01120  Microbial metabolism in diverse environments
rho01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHOM_04745
   00030 Pentose phosphate pathway
    RHOM_04745
   00051 Fructose and mannose metabolism
    RHOM_04745
   00052 Galactose metabolism
    RHOM_04745
  Energy metabolism
   00680 Methane metabolism
    RHOM_04745
Enzymes [BR:rho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RHOM_04745
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RHOM_04745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEN96069
UniProt: G2T2C4
Position
complement(1022172..1023410)
Genome map
AA seq 412 aa AA seqDB search
MNQKNCMVAQSGGPTVAINASLAGVIDGVSASSMYDTVYGSLNGITGILNDDLLNLTELM
DGHPEYLSRLAQTPAMYLGSCRYKLPHYLDDDSPYVFIFKQFETYHIEAFFYIGGNDSMD
TVLKLSEYGKRIGSSVRIIGIPKTIDNDLCETDHTPGFGSAAKYIASSLLEIAHDTFIYA
VKSVTIVEIMGRDAGWLTAAAALARNGYNTAPHLIYLPEVAFDPEDFLLDVKRLLFERNN
VIVAVSEGIRDASGNYISASEQSIDTFGHSQLSGAGKTLEFLVKEKLGVKVRSVEINVLQ
RCAAHLASQTDLDESFALGKKAVALSEEGVTASMVTIERTSNAPYTVDYSYAEIRQIANE
AKSVPREWINSAGNDIEQPLLDYLAPLILGESQVSYHNGLPVYMDVSHLSKH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaaaaattgtatggtagcccagtccggcggtcctaccgttgcgatcaacgca
agtcttgccggtgtcattgacggcgtgtccgcctcttccatgtacgacaccgtttacggc
tcgctcaacggaatcaccggtattttaaacgatgaccttctcaacctcacggagcttatg
gacggtcatccggaatatctttcccgccttgcgcagacacctgcgatgtacttaggctcc
tgccgctacaaacttccccattatctggatgatgattcaccctatgtcttcatatttaag
cagtttgaaacttaccacattgaagcgtttttctatatcggcggcaatgattccatggac
accgtgttaaagctgtccgagtacggaaaacgcatcggcagttccgtccgcattatcggc
atcccgaagaccatcgacaatgatctctgcgagaccgatcacaccccgggctttggctct
gccgcaaaatacattgcctcctcgctcttagagatcgcgcacgacacctttatctacgcg
gtcaaaagcgtgaccatcgttgagatcatgggacgcgacgcaggatggctgaccgctgcc
gcggcactcgcgcgcaacggatacaacaccgccccgcacttaatctatctgccggaagtc
gctttcgacccggaggatttccttttagacgtcaagcgtctccttttcgagcgcaacaat
gtcatcgtcgcagtgtccgagggcatccgcgacgcctccggcaattacatcagcgcgtcc
gagcagtccatcgacacgttcggtcacagtcagttaagcggcgccggcaagacacttgag
ttccttgtcaaggaaaagcttggtgtcaaggtgcgttccgtggaaatcaatgtcctgcag
cgctgtgccgcacatctggcttcccagacagacttagacgaatctttcgcactcggcaaa
aaagccgtcgcactctccgaggagggtgtgacagcttccatggtcaccatcgagcgcact
tcaaacgcaccgtataccgtggattactcctatgcggaaatccgccagatcgccaacgag
gcaaagagcgttccgagagagtggatcaacagtgccggcaacgacatcgaacagcctctg
ctcgactatcttgctccgctgattcttggcgaatcgcaggtctcctatcacaacggtctg
cctgtatacatggatgtgagccacctgtctaagcactag

DBGET integrated database retrieval system