KEGG   Roseburia hominis: RHOM_05175Help
Entry
RHOM_05175        CDS       T01621                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rho  Roseburia hominis
Pathway
rho00010  Glycolysis / Gluconeogenesis
rho00051  Fructose and mannose metabolism
rho01100  Metabolic pathways
rho01110  Biosynthesis of secondary metabolites
rho01120  Microbial metabolism in diverse environments
rho01130  Biosynthesis of antibiotics
rho01200  Carbon metabolism
rho01230  Biosynthesis of amino acids
Module
rho_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rho_M00002  Glycolysis, core module involving three-carbon compounds
rho_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHOM_05175 (tpiA)
   00051 Fructose and mannose metabolism
    RHOM_05175 (tpiA)
   00562 Inositol phosphate metabolism
    RHOM_05175 (tpiA)
Enzymes [BR:rho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RHOM_05175 (tpiA)
Exosome [BR:rho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RHOM_05175 (tpiA)
  Exosomal proteins of bladder cancer cells
   RHOM_05175 (tpiA)
  Exosomal proteins of melanoma cells
   RHOM_05175 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEN96154
UniProt: G2T185
Position
1128926..1129675
Genome map
AA seq 249 aa AA seqDB search
MARKKIVAGNWKMNMTPSQAVKLVEELKPLVVSDDVEVVYCVPAIDIVPVVEAVKGTNVA
VGAENMYYEEKGAYTGEISPEMLVDAGVKYVIIGHSERRDYFKECDCMLNKKVKKAFEHN
LTPILCCGETLEQREMGVTLDWIRLQIKSDLKDITAEQVASMVIAYEPIWAIGTGKTATT
AQAQEVCKAIRDCIAEVYDTDTAEKVRIQYGGSVNAGNAAELFAQPDIDGGLVGGASLKA
DFGKIVNYK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaaaattgtggccggcaactggaagatgaacatgactccaagccaggca
gtaaagttagtagaagagttaaagccgcttgtagtaagtgatgatgttgaagttgtatac
tgtgttccggcaatcgatatcgtaccggttgtagaggcagtcaaaggtactaacgttgca
gtcggtgcagagaatatgtactacgaggagaaaggtgcctacacaggagagatctctccg
gagatgctggtagacgcaggcgtgaagtatgttatcatcggtcattccgagagacgtgac
tacttcaaagagtgcgactgcatgctgaacaagaaagttaagaaagcattcgagcacaat
ctgaccccgatcctttgctgcggagagacattagagcagagagagatgggcgttactctt
gactggatccgtcttcagatcaaatcggacttaaaggatattaccgcagagcaggttgct
tccatggtaatcgcatatgagccgatctgggcaatcggaaccggcaagacagcaacaacc
gcacaggcacaggaagtctgcaaggcaatccgcgactgcatcgctgaggtatatgatacc
gatacagctgagaaggttcgtatccagtacggcggatctgtcaatgcaggaaatgcggca
gaactgttcgcacagccggatatcgatggcggtcttgtaggcggcgcatccttaaaggct
gactttggaaagattgtaaactataagtaa

DBGET integrated database retrieval system