KEGG   Roseburia hominis: RHOM_05355Help
Entry
RHOM_05355        CDS       T01621                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
rho  Roseburia hominis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rho01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rho00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rho00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rho00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:rho00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1169602..1171566
Genome map
AA seq 654 aa AA seqDB search
MEKYMETDLRYLKSLANQYPTVAAAATEIINLQAILSLPKGTEHFITDIHGEYDQFQHVI
RNGSGAIKRKIEEEFGNAISAGEKKVIATLIYYPEQKLEQVLKTEENMEDWYKVSLYRLI
RICKSASSKYTRSKVRKALPKDFAYVIEELLTGRPDVSDQEAYYNEIIRSVIRTGRAPEL
VIAFCNLIRRLVVDHLHVVGDIFDRGPYPNLIMDTLMQHHSVDIQWGNHDIYWMGAAAGS
RPCICNAIRISAKYGNLNLLEDGYGINLVPLARLAMSRYDKDPCTCFKLDYREDEYDVRD
AMLDEKMHKAITVIQFKLEGQMIMRHPEFGMDERLLLDKINIEKGTVCVEGKEYPMKDLN
FPTIDWKHPYELSSEEEDVMERITQAFLNCEKLQRHVRFLFTQGSLYKVYNGNLLYHGCV
PMNEDGTFTRVNVYGKEYSGKALYDVLENYARKGYYAIDPGEKKKGLDILWFIWENQNSP
VFGKAKMTTFERYFIADTATHQEPKNPYYRLLEEEEVVNRILSEFGLEGAEAHIINGHIP
VEAKRGESPVKCGGKLLIIDGGFSKAYQPKTGIAGYTLIYNSYGLVLAAHEPFESVEKAV
QDGSDIASHTILVQHVVRRKLVADTDIGRELRASIRDLEALLQAYRDGILVEKI
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatatggaaacagatctgcggtatttaaaaagtctggcaaatcagtatccg
accgtggctgcggcagcgacggagatcattaacctgcaggcgattttaagcctgccaaag
ggaacagaacatttcattacagatattcacggcgagtacgatcagttccagcacgtgatc
cggaacggttccggagcgattaagcgcaagatcgaggaagaattcgggaatgcgatcagt
gcgggagagaagaaagtgattgcgaccctgatctattatccggagcagaagctagagcag
gtgttaaagacagaagaaaatatggaggactggtataaggtctccctataccggctgatc
cgcatctgcaagagcgcttcgtcaaaatataccagatccaaggtgcgaaaagcgctgccg
aaagattttgcgtatgtgatcgaggaactgctgaccggcagaccggatgtctccgatcag
gaagcttattataatgagatcatccggtctgtgatccgcacaggcagggcgccggagctt
gtgattgcgttctgcaatctgatccgcaggcttgtggtggatcatctgcatgtggtggga
gatattttcgacaggggaccgtacccgaatctgattatggataccttgatgcagcatcat
tccgtggatattcagtgggggaaccacgatatatactggatgggagcggcggcgggaagc
agaccctgcatctgcaacgcgatccgtatctctgccaagtacggcaatctgaacctttta
gaggacggatacggcatcaatctggtgccgctcgccagacttgccatgagcagatacgac
aaggatccctgcacctgctttaagctggattaccgggaggatgagtacgatgtgcgtgac
gccatgctggatgagaaaatgcacaaggcgattacggtgatccagttcaagctggaggga
cagatgatcatgcgtcacccggagttcgggatggatgagcggcttttgctggacaagatc
aatatcgaaaaaggaacggtgtgtgtggaggggaaggaatacccgatgaaggatctgaac
ttcccgacgatcgactggaagcatccgtatgaactgtcatcggaggaggaggacgtcatg
gagcggatcacgcaggcgttcttgaactgtgaaaaattacagcgtcacgtccgttttctg
ttcacacagggcagcctgtacaaggtctacaacgggaacctgctctaccacggctgtgtg
ccgatgaacgaggacggaacctttaccagagtaaatgtgtacggaaaagaatattccggc
aaggcgctctacgatgtgctggagaattacgcgagaaaagggtactacgcgattgatccc
ggggagaagaaaaaggggctggatatcttgtggtttatctgggaaaaccagaattccccg
gtgttcggaaaagcaaaaatgacgacgtttgagcgctattttatcgcggacacagcgacg
caccaggagccgaagaacccgtactaccgcctgctggaggaggaagaggtggtcaaccgc
atcctctcggaattcgggcttgagggcgcggaggcacatatcatcaacggccatattccg
gtggaggcgaagcggggagagtccccggtaaaatgcggcgggaagctgctcattattgac
ggcggattctccaaggcctaccagccgaagacggggattgcgggatatacgctgatctat
aattcctacggtctggtgcttgcggcgcatgaaccgtttgagtcggtcgaaaaggcggtg
caggacggaagcgatatcgcgtcgcatacgattctggtgcagcatgtcgtgcgacgcaag
ctggtggcggatacggacattggaagggagctgcgcgcttcgatccgtgatctggaggcg
ctgctgcaggcataccgggacggcatcctggtggagaagatttaa

DBGET integrated database retrieval system