KEGG   Roseburia hominis: RHOM_05725Help
Entry
RHOM_05725        CDS       T01621                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rho  Roseburia hominis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RHOM_05725
Enzymes [BR:rho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RHOM_05725
Peptidases [BR:rho01002]
 Cysteine Peptidases
  Family C44
   RHOM_05725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1242047..1243864)
Genome map
AA seq 605 aa AA seqDB search
MCGISGFCDFSKNFKKEPVLWERILTDMHHALAHRGSDSFGTYLDTHVGLSHARLSIRDI
AGGSQPIIRQDGERTCAIVYNGEIYNTDELLPPLLAAGYTFSTTSDTEVILCAYLHYGRD
FVSRLNGIFAFAIWDGGTGELLLYRDRAGTKPLFYSTPGGTLVFGSEPKALFCHPDITPT
IDENSLLELLSIGPARTPGNGIFSGMHEVLPGHYQIFSREGTKQVCYWDLTAAPHTDSYE
KTVEMVSYLVRDAVKRQMVSDVPVCTFLSGGIDSSIVTAIAAGCMQKDGQTLNTFSFDFA
ENDKYFQSNAFQPERDLPYVNIMLAHCQTHHTYLECSQSTLYEALFSAVDARDLPGMTDV
DASLLYFCSLVARHNKVTLTGECADEIFGGYPWFYRPELLNRDGFPWSADVSARAAFLSG
DVTDRLDLAGYSRARYEETISASPKLPGESPEEARRRAVGYLNIKWFMQTLLDRMDRTSM
YSGLEARVPFADHRIMEYVFNVPWSMKYQNGVEKTLLRDACADLLPAELLHRKKKPVPED
LPPGLREASRGSPAPDHKRSERAGLPADRSKKSQGIPRRSQGAWQTVVRSAHGGTPAYGI
FYPAQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctccggtttctgcgacttttctaaaaattttaaaaaggaacccgtcctc
tgggaacgtattctcaccgacatgcatcacgcgctcgcccaccgcggcagcgacagtttc
ggcacctatttagacacgcatgtggggctttcccacgccagactcagcatccgcgatatt
gcgggcggcagtcagcccataatccggcaggatggggaacgcacctgcgcgatcgtctac
aatggcgagatctacaacaccgacgaactgctgccgccgcttctcgccgctgggtatact
ttttccaccacttccgacacggaagtcattctctgcgcctatctgcactatgggagggat
tttgtcagccgcctgaacggcatttttgcctttgcgatctgggacggcggaaccggtgaa
ctgcttttgtaccgtgaccgtgccggtaccaaaccgctcttctacagcaccccgggcggc
acactggtctttggctccgagccaaaagcgctcttctgccacccggatatcacgcccacc
atcgatgaaaacagcctgttggagcttctgtccatcggtccggcacgcacacccggcaac
ggcattttttccggcatgcacgaggttctccccggtcattatcagattttctcccgggag
ggcacgaagcaggtgtgctactgggatcttaccgccgccccgcacaccgattcctatgaa
aaaacggtggagatggtctcttatctggtgcgcgatgccgtaaagcggcagatggtctcg
gacgtcccggtctgcacctttctctccggcggcatcgactcttccatcgtaaccgcgatc
gccgcaggctgcatgcaaaaggacgggcagactctaaatacgttctcttttgattttgcg
gaaaacgataaatatttccagtcaaacgcctttcagcccgagcgcgatctgccctacgtc
aacatcatgctcgcccactgccagacgcaccacacctatctggaatgctcccagagcacg
ctttatgaggcacttttttcggcggtcgacgccagggatcttcccggcatgaccgatgtg
gatgcctctctgctctacttctgttctctggtcgccagacacaacaaagtcacactgacc
ggagaatgtgccgatgaaatcttcggcggctatccctggttctaccgcccggagctttta
aaccgtgacggttttccgtggtctgccgatgtctctgcgcgcgccgcattcctgtccggc
gacgtgactgaccgcctggatctcgccggttactcgcgcgcccgctatgaagagactata
agtgcttccccgaagcttcccggcgaatcgcccgaggaagcccgcaggcgtgccgtcggc
tacctgaatatcaagtggttcatgcagacgctcctcgaccgcatggaccgcaccagcatg
tactccggtctggaagcgcgcgttccctttgctgaccaccgcatcatggagtacgtcttc
aacgtgccgtggagcatgaagtatcagaacggcgtggaaaaaacgctgctgcgcgacgcc
tgcgcggatctgcttccggcagaactgctgcaccgcaaaaaaaagcccgtacccgaagac
ttaccacccgggctacgagaagcttctcgcggatcacctgcgccggatcataagcgatcc
gaacgcgccggtctacccgctgatcgatccaaaaaaagccaaggcattcctcgccgctcc
caaggagcttggcagaccgtggttcggtcagctcatggcgggaccccagcttatggcata
ttttatccagctcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system