KEGG   Roseburia hominis: RHOM_06410Help
Entry
RHOM_06410        CDS       T01621                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
rho  Roseburia hominis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RHOM_06410
  Lipid metabolism
   00600 Sphingolipid metabolism
    RHOM_06410
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RHOM_06410
Enzymes [BR:rho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RHOM_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416125..1418530
Genome map
AA seq 801 aa AA seqDB search
MENRVYLNDDWKFSEQFTEEMLGDGFDVGNMIPVRLPHTAKETPLHYFDESVYQMVSGYR
RDVYIPEEWKGKRLLLTIDGAAHESEVYWNGKKIGEHHCGYTAFTMDISDDAVYGIRNTL
VVKVDSRESVNIPPFGFVIDYMTYGGLYREVWLDIKEKTYLKDVFVRGDLSGDSGRLISE
ITAEGGGENLSVRQKIKRCGESGYRLLGECELTGTKLVLDYTVESVLPWDTVHPVCYEVC
TQLIQDEKVLDENVTVTGFRHAEFKADGFYLNGKKVKLRGLNRHQSYPYVGYAMPESMQR
MDADILKYELGVNAVRTSHYPQSHYFIDQCDRIGLLVFMEIPGWQHIGDEAWKDQAVINV
RDMVMQYRNHTSIILWGVRINESQDDDDFYRRTNAAAHELDPSRPTGGVRAHKKSSLLED
VYTYNDFVHDGTNQGCEKKAAVTSDPKKPYLISEYNGHMYPTKAFDWEEHRAEHALRHVR
VLDAAAAEGDIAGSFGWCMFDYNTHKDFGSGDRICYHGVMDMFRNPKLAARVYECQQEEH
TVLELSSSMDIGEHPGCNRGETYIFTNADSVRMYKNDRFIKEYKREDSPWKHLPHGPLVI
DDYIGDAIEKDEHFTTAQGKGIKDALNATARYGLSHLPKSVYVTALKMLLLYHMKPTDAV
VLYNRYIGDWGGTSTTYRFEAVSDGGVTAELIKKPMTKVVLFARADHTGLQEKSTYDVAA
IRIEARDEYGNLLSFFNEPVSFEVSGPVELIGPSVISLEGGMGGTYIKTTGESGEARLVI
RNAQTEPVELRFAAAAERQRL
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagagtatatttaaatgacgactggaagttttcggagcaatttacggaagaa
atgctaggcgacggctttgacgtgggaaacatgattccggtacggcttccgcacacggca
aaggagacaccgcttcactattttgacgaatctgtttaccagatggtcagcggataccgc
agagatgtctatattccggaagaatggaaaggaaaacgtctgctgctcacgattgacggg
gcggcgcatgagagcgaagtctactggaacgggaagaagatcggggaacatcactgcggc
tacacggcattcacgatggacatcagcgacgatgccgtctacggcatccgcaacacgctg
gtggtcaaggtggacagcagggagagcgtgaatataccgccgtttggatttgtgattgac
tatatgacatacggcggactctaccgtgaggtgtggctcgacatcaaggagaaaacctat
ctgaaggatgtgtttgtgcggggagatctttccggtgactccggcagactgatctccgag
attacggcggaaggcggtggggagaatcttagcgtcagacagaagatcaaaagatgcggc
gagagcggctaccgtcttctgggcgaatgtgaactgaccggaacaaagcttgtgctcgac
tatacggtggaatccgttctgccgtgggacaccgttcatccggtctgctatgaggtgtgc
acacagctcatccaggatgaaaaggtgctggatgaaaatgtgacggtcacaggctttcga
catgccgagtttaaggcggacggtttttatctgaacggtaaaaaagtaaagctccgcgga
ctcaaccgacatcagagctatccgtatgtgggatatgccatgccggaatccatgcagcgg
atggacgcggatattttaaagtatgagcttggcgtcaacgccgtgcggacatcccactat
ccgcagtctcattactttatcgaccagtgtgacagaatcggacttctggtatttatggag
attccgggatggcagcacatcggcgatgaggcgtggaaggatcaggcggttataaatgtg
cgcgatatggtgatgcagtaccgcaatcacacgtccatcattctctggggcgtgcgcatc
aacgagtcgcaggacgatgatgatttttaccgcaggacgaacgcggcggcgcacgaactc
gatccatccagaccgacgggcggtgtgcgggcgcacaaaaagagcagtcttctggaagac
gtctacacttacaatgattttgtgcatgacggcacgaaccagggatgtgagaaaaaggcg
gcggtgacatccgatccgaaaaagccgtatctgatcagcgagtacaatggccacatgtat
ccgaccaaggcattcgactgggaggaacaccgcgcggaacatgcgctgcgccatgtgcgg
gtgctcgacgcggcggctgcggagggtgacattgcaggaagcttcggctggtgcatgttc
gactacaacacacacaaggatttcggcagcggagaccgcatctgttaccacggcgtgatg
gatatgttccgcaatccgaagctggcggcgagggtctatgaatgccagcaggaggagcat
acggttctggaactgagttcttccatggacataggggagcacccgggctgcaaccgcggc
gagacctacatttttaccaacgcagacagtgtgcggatgtacaaaaacgaccgttttatc
aaggaatacaagagagaggattccccgtggaaacatctgccgcacggaccgctcgtgatc
gacgattatatcggagatgcgatcgagaaggacgaacattttacaacggcgcagggaaag
ggaatcaaggatgcgttgaatgcgaccgcacgctacggactgtcgcatcttccgaaatcc
gtgtatgtgacggcgcttaagatgctgctcctttatcacatgaagccgaccgatgcggtg
gtgctctataaccgctatatcggagactggggaggcacttccacgacataccggtttgag
gcggtgtcggacggcggcgtgactgcggaactcatcaaaaagccgatgacaaaggttgta
ctttttgcacgggcggatcacacaggacttcaggagaaaagcacctacgatgtggcggcc
atccggattgaggcgcgggacgaatacggcaatctgcttagcttctttaatgagccggta
agctttgaggtgagcggaccggtggagctgatcggaccgtccgtcatctcgctggagggc
ggaatgggcggcacttatataaagacgacgggtgagagcggtgaggcacggcttgtcatc
cggaatgcacagaccgaaccggtggaactgcgctttgcggcagcggcagagcgacagaga
ttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system