KEGG   Roseburia hominis: RHOM_06550Help
Entry
RHOM_06550        CDS       T01621                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rho  Roseburia hominis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHOM_06550
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHOM_06550
Enzymes [BR:rho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RHOM_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1445037..1445810
Genome map
AA seq 257 aa AA seqDB search
MILDQIVSDKKRRLPEHKRRIPEQEMRKLAEAYEGSHHDFKGALEGDVISIIGEFKKASP
SFGKIKSKINLLDRIEEYNASVDAISCLTEEDHFDGSTAYLEQIRQMTDLPILRKDFMID
PYQFYEARAIGADAVLLIAAILDDVQMHEFYQLAGELGLDALVEVHDEAEMERALKLDAK
IIGVNNRNLKDFSIDLQTTERLSRMVPQEKLLVAESGIVSDEDVEFLKACGVNAFLIGRA
FMEAEHPGEVAARWKQR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatcagattgtgagcgataaaaaaagaagactgccggaacataagagacgg
ataccggagcaggagatgcgaaagctggcggaggcgtatgagggcagccatcatgatttt
aagggagcgcttgagggagatgtcatttccatcatcggagagttcaaaaaggcgtcccca
agtttcggtaaaattaaaagcaagattaacttactggatagaattgaggaatacaatgct
tctgtggatgcgatctcctgcctgacggaggaggatcactttgacggaagcacggcgtac
ttagaacagatccggcagatgaccgatcttccgatcctgcgcaaggatttcatgattgat
ccataccagttctatgaggcgcgggcgatcggtgcagacgcggtgcttctcattgcggca
atcttagacgatgtgcagatgcatgaattctaccagcttgccggggagctggggctggat
gcgttagtcgaggtacacgacgaggcggagatggagcgggcgttaaagctggatgcaaag
atcatcggcgtcaataaccgcaatctgaaggatttttccattgacctgcaaacaacggag
cgattaagccgcatggtgccgcaggagaagcttctggtggcggaaagcggcattgtatcg
gatgaggatgtggagttcttaaaagcatgcggtgtgaatgcatttctgatcgggagagcc
tttatggaggcggagcacccgggagaggtggcagcgcgctggaagcagcggtag

DBGET integrated database retrieval system