KEGG   Roseburia hominis: RHOM_06560Help
Entry
RHOM_06560        CDS       T01621                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rho  Roseburia hominis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHOM_06560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHOM_06560
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHOM_06560
Enzymes [BR:rho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHOM_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1446546..1447757
Genome map
AA seq 403 aa AA seqDB search
MNRKAYYGAFGGQYVAESLMNTLEELDAAFEEAIRDPEFLKQYHYYLEQYVGRETPLYYA
ERLSEKYGMKMYLKREDLNHTGAHKINNVIGQILLAKRMGKKKVIAETGAGQHGVATATG
AALFDMECTVYMGAEDIKRQSLNVMRMEMLGAKVVSVTSGSNTLKDATNEAIRTWAKTAE
DTFYIIGSAVGPYPYPKMVKEFQSVISREAKKQILAAEGKLPDVVLACVGGGSNSIGMFA
DFIEEKGVKLIGVEAAGKGIETGEHASAMALGEPGVLHGMRSYLLQDADGNVQLAHSISA
GLDYPGVGPEHAYLKESGRARYVAIRDDEAMDALMELCRLEGIIPAIESAHAVAYAMKYA
RERKEAVGEKQAAKETMVICLSGRGDKDVNTIADYLAGKGYLN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggaaagcatattacggagcatttggcggacagtatgtggcggagtcgctgatg
aatactttagaggaactggatgcggcattcgaggaagcaatccgtgatccggaatttctc
aaacaataccactattatctggaacagtatgtcgggagagagacaccgctgtattacgcg
gagcgtctcagtgaaaagtacggcatgaaaatgtatttaaagcgtgaggatttaaaccat
accggcgcacacaagattaacaatgtgatcggacagattctgctggcgaagcgcatgggc
aagaaaaaggtgatcgcagagaccggagcggggcagcacggcgtggcgacggcaaccggc
gcagcgctctttgacatggagtgcacggtctatatgggagccgaggatatcaaaagacag
tcactaaacgtaatgcgcatggagatgctcggcgcgaaagttgtcagtgtcacttccgga
agcaatacgctaaaggatgcgaccaacgaggcgatccgcacctgggcaaaaacggcggag
gataccttttacatcatcggttcggctgtgggaccgtatccgtacccgaagatggtgaag
gagtttcagagcgtcatcagccgcgaggcgaaaaaacagatccttgcggcggagggcaag
cttccggatgtcgtgctggcatgtgtgggaggcggatcgaactccatcggcatgtttgcg
gattttattgaggagaagggggtaaagctgatcggcgtggaggcagccggaaagggaatc
gagaccggggaacacgcgtcggcgatggcgctcggcgagccgggagttctgcacggcatg
cgttcctatctgctgcaggatgcggacggcaatgtccagcttgcacattccatctcagcg
gggctggattatccgggcgtcggtccggagcacgcgtacttaaaggagagcggacgcgca
cgatatgtggcaatccgggatgatgaggcgatggatgcgctgatggagctgtgcagactg
gagggaatcattcctgcgatcgagagcgcccatgcagttgcctatgcgatgaagtacgcg
agggagcgcaaagaggcggtcggtgagaagcaggcggcaaaggagaccatggtcatctgt
ctgtcgggccgcggcgacaaggatgtcaatacgatcgcagattatcttgcaggaaaagga
tatttaaattga

DBGET integrated database retrieval system