KEGG   Roseburia hominis: RHOM_06565Help
Entry
RHOM_06565        CDS       T01621                                 

Definition
(GenBank) tryptophan synthase
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rho  Roseburia hominis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHOM_06565
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHOM_06565
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHOM_06565
Enzymes [BR:rho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHOM_06565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1447795..1448586
Genome map
AA seq 263 aa AA seqDB search
MNRIEARMNACSKKQEKAFITYVTAGLPDLAATKEIIRAQERGGCDVIELGVPFSDPVAD
GPVIQDASYRAICGGVNVKKIFAMMQELRTEGVTVPIIFMMYYNTILHYGVEAFVKRCNE
AGVDGLIVPDLPFEEQAELMTVLNASEDTILIQLVSPVSGARIPKILAGARGFVYCVSSM
GVTGQGAEFHKEVRSYLTAVREATDLPVMMGFGIRTAADVLPLADLIDGAIVGSYFIRLL
EEQGFAPEAAETYCRTFKKELNA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatagaagcgcgtatgaacgcctgcagcaaaaagcaggagaaagcatttatt
acttatgttaccgcgggactgccggatctggcagccacaaaagaaatcatccgggcgcag
gagcgcggcggctgcgacgtgattgagcttggcgtgccgttttccgatccggtggcggac
ggaccggtcatccaggacgcatcgtaccgtgcaatctgcggcggggtgaatgtgaagaag
atttttgcaatgatgcaggaactgcgcacggagggtgtgacggtcccgatcatcttcatg
atgtattacaacacgatcctgcactacggcgtggaagcgtttgtaaaaagatgcaatgag
gcgggggtggacggactgatcgttccggatctgccgtttgaggagcaggcggaactgatg
acggtgcttaacgcatcggaggatacgatcttaatccagctcgtgtcgccggtgtccggg
gcgcggattccaaagattctcgccggagcgcgggggttcgtctactgtgtatcgtccatg
ggtgtcacggggcagggagcagagttccataaggaggtaagaagctatcttaccgcagta
cgggaagcgacagatctgccggtgatgatgggctttggcatccggacggcggcggacgtt
ctgccgcttgcggatctgatcgacggggcgatcgtcggaagttattttatcaggctgctg
gaggagcagggctttgcgccggaggcggcggagacatactgccggacctttaaaaaggaa
ctgaacgcatag

DBGET integrated database retrieval system