KEGG   Roseburia hominis: RHOM_06565Help
Entry
RHOM_06565        CDS       T01621                                 

Definition
tryptophan synthase
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rho  Roseburia hominis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHOM_06565
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHOM_06565
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHOM_06565
Enzymes [BR:rho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHOM_06565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1447795..1448586
Genome map
AA seq 263 aa AA seqDB search
MNRIEARMNACSKKQEKAFITYVTAGLPDLAATKEIIRAQERGGCDVIELGVPFSDPVAD
GPVIQDASYRAICGGVNVKKIFAMMQELRTEGVTVPIIFMMYYNTILHYGVEAFVKRCNE
AGVDGLIVPDLPFEEQAELMTVLNASEDTILIQLVSPVSGARIPKILAGARGFVYCVSSM
GVTGQGAEFHKEVRSYLTAVREATDLPVMMGFGIRTAADVLPLADLIDGAIVGSYFIRLL
EEQGFAPEAAETYCRTFKKELNA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatagaagcgcgtatgaacgcctgcagcaaaaagcaggagaaagcatttatt
acttatgttaccgcgggactgccggatctggcagccacaaaagaaatcatccgggcgcag
gagcgcggcggctgcgacgtgattgagcttggcgtgccgttttccgatccggtggcggac
ggaccggtcatccaggacgcatcgtaccgtgcaatctgcggcggggtgaatgtgaagaag
atttttgcaatgatgcaggaactgcgcacggagggtgtgacggtcccgatcatcttcatg
atgtattacaacacgatcctgcactacggcgtggaagcgtttgtaaaaagatgcaatgag
gcgggggtggacggactgatcgttccggatctgccgtttgaggagcaggcggaactgatg
acggtgcttaacgcatcggaggatacgatcttaatccagctcgtgtcgccggtgtccggg
gcgcggattccaaagattctcgccggagcgcgggggttcgtctactgtgtatcgtccatg
ggtgtcacggggcagggagcagagttccataaggaggtaagaagctatcttaccgcagta
cgggaagcgacagatctgccggtgatgatgggctttggcatccggacggcggcggacgtt
ctgccgcttgcggatctgatcgacggggcgatcgtcggaagttattttatcaggctgctg
gaggagcagggctttgcgccggaggcggcggagacatactgccggacctttaaaaaggaa
ctgaacgcatag

DBGET integrated database retrieval system