KEGG   Roseburia hominis: RHOM_06635Help
Entry
RHOM_06635        CDS       T01621                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rho  Roseburia hominis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHOM_06635
Enzymes [BR:rho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RHOM_06635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1461234..1462679
Genome map
AA seq 481 aa AA seqDB search
MGKEARKFADFLEKSGQKYWQILPICPTSYGDSPYQSFSSFAGNPYFIDLEYLCKEKLLK
KAECESFPWGKKADKVDYGVMYESRYKLLKIAFERFLRAEPDDFEAFCEKEADWLSDYAL
FMALKDANGGNAWFSWEKDLKMRKPEALAEARSTYAKDIRFYQMLQYLFFKQWWELKAYV
NEKGIEIIGDVPIYVAGDSADVWANPEEFYLDEDLNPIDVAGCPPDAFSEDGQLWGNPLF
RWDVMKKNGYTWWTKRIAAMSKLYDIVRIDHFRGFDSYYAIPAKDKTAKNGEWRKGPGMD
LFHTLEQKLGRLNIIVEDLGFLTPSVLKLVADSGFPGMKVIQFAFDSREGSNYLPHTYTE
HCVVYTGTHDNDTLLGWMKTAPKESVKFAKEYLNLTKEEGYNWGMMRGAWSSVGELAVVP
MQDLIGLGSEARMNTPSTLGGNWQWRATSDQITVKLAKRLYNYMEMYGRLWVGEDADRKE
Q
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagaagccagaaagtttgcagactttcttgaaaaatcaggacagaaatactgg
cagattcttccgatctgccccacaagttacggtgattcgccgtatcagtcattttccagc
tttgcagggaatccgtattttatagatctggaatacctgtgtaaggaaaaactgttgaaa
aaggcggagtgtgagtctttcccgtggggaaagaaagcagacaaggtggattacggcgtg
atgtacgagtcgcgctataagctgttaaagatcgcgtttgagcggttccttcgcgcagag
ccggacgattttgaggcgttctgtgaaaaagaggcagactggctttctgattatgcgctg
tttatggcgttaaaggatgccaacggcggaaacgcatggttttcctgggaaaaagattta
aagatgagaaaaccggaggcacttgccgaggcgagaagcacctatgcgaaggatatccgc
ttttatcagatgttacagtatctgtttttcaagcagtggtgggagctaaaagcctatgtg
aatgaaaaaggtattgagatcatcggggatgttccgatctacgtcgcaggggattctgct
gacgtatgggcgaatccggaagagttctatctggatgaggatttaaatccgattgatgtg
gcagggtgtccgccggatgcattttccgaggacggacagctctggggcaatccgttgttc
cgttgggatgtaatgaagaaaaacggatacacctggtggacgaaacgcattgcggcaatg
tcaaagctttacgatattgtccggattgaccattttcgcggatttgattcctactatgcg
attccggcaaaggataagacggcaaagaatggtgagtggcgcaagggaccgggcatggat
ctgtttcatacgctggagcagaagcttggcagattaaacattatcgtggaggatctgggc
tttttgacaccgtccgtgttaaagcttgttgcggattccggatttccgggaatgaaagtc
atacagtttgcgtttgactcgagagagggaagcaattatctcccgcatacctacacggag
cactgtgtggtgtacaccggaacacatgacaatgatacgctgcttggctggatgaagact
gcgccgaaggagagcgtcaaatttgcaaaggaatacttaaacctcacgaaagaggaaggc
tataactggggcatgatgcgtggtgcatggtcttcggtcggggagcttgcggtggtgccg
atgcaggatctgatcggtcttggttcggaggcacgcatgaacacgccgtccaccctgggg
ggcaactggcagtggcgtgcaacatcagatcagattaccgtcaagcttgccaaacggctt
tataattatatggaaatgtacggacgtctctgggtgggcgaagatgcagacagaaaagag
cagtaa

DBGET integrated database retrieval system