KEGG   Roseburia hominis: RHOM_08010Help
Entry
RHOM_08010        CDS       T01621                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rho  Roseburia hominis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHOM_08010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHOM_08010
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHOM_08010
Enzymes [BR:rho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHOM_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1745562..1747058)
Genome map
AA seq 498 aa AA seqDB search
MKMELVYASTRDAQERVTASQAILRGLANDGGLFVPTQIPALDVPMEELGKMSYQETAYE
VMKRFLTDFTEEELKHCINSAYDSKFDTEEIAPLVEADGAYYLELFHGSTIAFKDMALSI
LPYLLTTAAKKNHVKNEIVILTATSGDTGKAALAGFSDVPGTKIIVFYPKNGVSPIQEKQ
MVTQKGDNTFVVGIHGNFDQAQTGVKKMFSDAALAKEMDAAGYQFSSANSINIGRLVPQI
VYYVYAYAKLYANGVIAKDEPVNVVVPTGNFGNILAAFYAKNMGIPIAKLICASNENKVL
YDFFSTGTYDKNREFMLTSSPSMDILISSNLERLIYRIAGNDAEKNAALMRELTTTGKYE
ITPEMRAQLKDFYGNYTSEAETAEVIRALYEKTGYVIDTHTAVAAGVYGKYKKDTGDVDT
KTVIASTASPFKFTRSVMDAIDHKYDSMSDFELVDELSRIANVAVPQAIEEIRNAKVLHD
TVCEVDEMPQVVKNFLKI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggaattagtgtatgcaagtacgagagacgcacaggaaagagtaacggcatcg
caggcgattctgcgtggtctggcaaatgacggaggactgtttgtaccgacacagattccg
gcgctggatgtgccgatggaagagcttggcaaaatgtcctatcaggagacagcatatgaa
gtcatgaagcgttttctgacggattttaccgaggaggagttaaagcactgtatcaattcc
gcgtatgacagcaagttcgacacagaggagatcgcaccgcttgtggaggcggacggcgca
tattacctggaactgttccacggttccacgatcgcttttaaggatatggcactgtccatt
ctgccgtatctgctgacgaccgctgcgaagaagaatcatgtaaagaatgagatcgtgatt
ctgactgccacctcgggagataccggaaaggcagcgctggcaggattttccgatgttccg
ggaacgaaaatcattgtattctatccgaagaacggtgtaagcccgatccaggagaagcag
atggtgacccagaagggtgacaatacgtttgttgtcggcattcacgggaactttgaccag
gcgcagactggcgtgaagaagatgttctcggatgcggcgctggcaaaagagatggacgct
gccggatatcagttttcctccgcgaattccatcaatatcggaagacttgtaccgcagatt
gtgtattatgtctacgcctacgcgaagctctatgcgaatggcgtgatcgcaaaggatgag
ccggtgaatgtcgttgttcctaccggcaacttcggcaatattctggctgcattttatgcg
aaaaatatgggaataccgattgccaagctgatttgtgcgtccaacgagaacaaagtttta
tatgatttcttctccacaggcacatatgacaagaaccgtgagtttatgctgacaagctca
ccgtcgatggacattctgatctccagcaatctggagcgtctgatttaccgcattgcggga
aacgacgccgagaagaatgccgcgctgatgagagaactgacgaccaccggaaaatacgag
atcacgccggagatgagagcacagcttaaggatttctatggcaattacacaagcgaggcg
gagacggcagaggtcatccgcgcactttatgagaagacaggctacgtgatcgatacacat
acagcggttgctgccggtgtatatggaaaatacaaaaaggataccggtgatgtagacacc
aagaccgtgattgcgtccacggcaagcccgtttaagtttacaagaagtgtgatggatgcc
attgaccacaagtacgacagcatgtccgattttgaactggtggatgagctgagccggatt
gcgaacgtagccgttccgcaggcgattgaggagatccgcaatgcgaaggtgcttcacgat
accgtgtgtgaagtggatgagatgccgcaggtagtaaagaatttcctgaaaatctaa

DBGET integrated database retrieval system