KEGG   Roseburia hominis: RHOM_08010Help
Entry
RHOM_08010        CDS       T01621                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rho  Roseburia hominis
Pathway
rho00260  Glycine, serine and threonine metabolism
rho00750  Vitamin B6 metabolism
rho01100  Metabolic pathways
rho01110  Biosynthesis of secondary metabolites
rho01120  Microbial metabolism in diverse environments
rho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHOM_08010
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHOM_08010
Enzymes [BR:rho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHOM_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEN96715
UniProt: G2T1P2
Position
complement(1745562..1747058)
Genome map
AA seq 498 aa AA seqDB search
MKMELVYASTRDAQERVTASQAILRGLANDGGLFVPTQIPALDVPMEELGKMSYQETAYE
VMKRFLTDFTEEELKHCINSAYDSKFDTEEIAPLVEADGAYYLELFHGSTIAFKDMALSI
LPYLLTTAAKKNHVKNEIVILTATSGDTGKAALAGFSDVPGTKIIVFYPKNGVSPIQEKQ
MVTQKGDNTFVVGIHGNFDQAQTGVKKMFSDAALAKEMDAAGYQFSSANSINIGRLVPQI
VYYVYAYAKLYANGVIAKDEPVNVVVPTGNFGNILAAFYAKNMGIPIAKLICASNENKVL
YDFFSTGTYDKNREFMLTSSPSMDILISSNLERLIYRIAGNDAEKNAALMRELTTTGKYE
ITPEMRAQLKDFYGNYTSEAETAEVIRALYEKTGYVIDTHTAVAAGVYGKYKKDTGDVDT
KTVIASTASPFKFTRSVMDAIDHKYDSMSDFELVDELSRIANVAVPQAIEEIRNAKVLHD
TVCEVDEMPQVVKNFLKI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggaattagtgtatgcaagtacgagagacgcacaggaaagagtaacggcatcg
caggcgattctgcgtggtctggcaaatgacggaggactgtttgtaccgacacagattccg
gcgctggatgtgccgatggaagagcttggcaaaatgtcctatcaggagacagcatatgaa
gtcatgaagcgttttctgacggattttaccgaggaggagttaaagcactgtatcaattcc
gcgtatgacagcaagttcgacacagaggagatcgcaccgcttgtggaggcggacggcgca
tattacctggaactgttccacggttccacgatcgcttttaaggatatggcactgtccatt
ctgccgtatctgctgacgaccgctgcgaagaagaatcatgtaaagaatgagatcgtgatt
ctgactgccacctcgggagataccggaaaggcagcgctggcaggattttccgatgttccg
ggaacgaaaatcattgtattctatccgaagaacggtgtaagcccgatccaggagaagcag
atggtgacccagaagggtgacaatacgtttgttgtcggcattcacgggaactttgaccag
gcgcagactggcgtgaagaagatgttctcggatgcggcgctggcaaaagagatggacgct
gccggatatcagttttcctccgcgaattccatcaatatcggaagacttgtaccgcagatt
gtgtattatgtctacgcctacgcgaagctctatgcgaatggcgtgatcgcaaaggatgag
ccggtgaatgtcgttgttcctaccggcaacttcggcaatattctggctgcattttatgcg
aaaaatatgggaataccgattgccaagctgatttgtgcgtccaacgagaacaaagtttta
tatgatttcttctccacaggcacatatgacaagaaccgtgagtttatgctgacaagctca
ccgtcgatggacattctgatctccagcaatctggagcgtctgatttaccgcattgcggga
aacgacgccgagaagaatgccgcgctgatgagagaactgacgaccaccggaaaatacgag
atcacgccggagatgagagcacagcttaaggatttctatggcaattacacaagcgaggcg
gagacggcagaggtcatccgcgcactttatgagaagacaggctacgtgatcgatacacat
acagcggttgctgccggtgtatatggaaaatacaaaaaggataccggtgatgtagacacc
aagaccgtgattgcgtccacggcaagcccgtttaagtttacaagaagtgtgatggatgcc
attgaccacaagtacgacagcatgtccgattttgaactggtggatgagctgagccggatt
gcgaacgtagccgttccgcaggcgattgaggagatccgcaatgcgaaggtgcttcacgat
accgtgtgtgaagtggatgagatgccgcaggtagtaaagaatttcctgaaaatctaa

DBGET integrated database retrieval system