KEGG   Roseburia hominis: RHOM_08010Help
Entry
RHOM_08010        CDS       T01621                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rho  Roseburia hominis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHOM_08010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHOM_08010
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHOM_08010
Enzymes [BR:rho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHOM_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1745562..1747058)
Genome map
AA seq 498 aa AA seqDB search
MKMELVYASTRDAQERVTASQAILRGLANDGGLFVPTQIPALDVPMEELGKMSYQETAYE
VMKRFLTDFTEEELKHCINSAYDSKFDTEEIAPLVEADGAYYLELFHGSTIAFKDMALSI
LPYLLTTAAKKNHVKNEIVILTATSGDTGKAALAGFSDVPGTKIIVFYPKNGVSPIQEKQ
MVTQKGDNTFVVGIHGNFDQAQTGVKKMFSDAALAKEMDAAGYQFSSANSINIGRLVPQI
VYYVYAYAKLYANGVIAKDEPVNVVVPTGNFGNILAAFYAKNMGIPIAKLICASNENKVL
YDFFSTGTYDKNREFMLTSSPSMDILISSNLERLIYRIAGNDAEKNAALMRELTTTGKYE
ITPEMRAQLKDFYGNYTSEAETAEVIRALYEKTGYVIDTHTAVAAGVYGKYKKDTGDVDT
KTVIASTASPFKFTRSVMDAIDHKYDSMSDFELVDELSRIANVAVPQAIEEIRNAKVLHD
TVCEVDEMPQVVKNFLKI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggaattagtgtatgcaagtacgagagacgcacaggaaagagtaacggcatcg
caggcgattctgcgtggtctggcaaatgacggaggactgtttgtaccgacacagattccg
gcgctggatgtgccgatggaagagcttggcaaaatgtcctatcaggagacagcatatgaa
gtcatgaagcgttttctgacggattttaccgaggaggagttaaagcactgtatcaattcc
gcgtatgacagcaagttcgacacagaggagatcgcaccgcttgtggaggcggacggcgca
tattacctggaactgttccacggttccacgatcgcttttaaggatatggcactgtccatt
ctgccgtatctgctgacgaccgctgcgaagaagaatcatgtaaagaatgagatcgtgatt
ctgactgccacctcgggagataccggaaaggcagcgctggcaggattttccgatgttccg
ggaacgaaaatcattgtattctatccgaagaacggtgtaagcccgatccaggagaagcag
atggtgacccagaagggtgacaatacgtttgttgtcggcattcacgggaactttgaccag
gcgcagactggcgtgaagaagatgttctcggatgcggcgctggcaaaagagatggacgct
gccggatatcagttttcctccgcgaattccatcaatatcggaagacttgtaccgcagatt
gtgtattatgtctacgcctacgcgaagctctatgcgaatggcgtgatcgcaaaggatgag
ccggtgaatgtcgttgttcctaccggcaacttcggcaatattctggctgcattttatgcg
aaaaatatgggaataccgattgccaagctgatttgtgcgtccaacgagaacaaagtttta
tatgatttcttctccacaggcacatatgacaagaaccgtgagtttatgctgacaagctca
ccgtcgatggacattctgatctccagcaatctggagcgtctgatttaccgcattgcggga
aacgacgccgagaagaatgccgcgctgatgagagaactgacgaccaccggaaaatacgag
atcacgccggagatgagagcacagcttaaggatttctatggcaattacacaagcgaggcg
gagacggcagaggtcatccgcgcactttatgagaagacaggctacgtgatcgatacacat
acagcggttgctgccggtgtatatggaaaatacaaaaaggataccggtgatgtagacacc
aagaccgtgattgcgtccacggcaagcccgtttaagtttacaagaagtgtgatggatgcc
attgaccacaagtacgacagcatgtccgattttgaactggtggatgagctgagccggatt
gcgaacgtagccgttccgcaggcgattgaggagatccgcaatgcgaaggtgcttcacgat
accgtgtgtgaagtggatgagatgccgcaggtagtaaagaatttcctgaaaatctaa

DBGET integrated database retrieval system