KEGG   Roseburia hominis: RHOM_10950Help
Entry
RHOM_10950        CDS       T01621                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
rho  Roseburia hominis
Pathway
rho00052  Galactose metabolism
rho00511  Other glycan degradation
rho00600  Sphingolipid metabolism
rho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RHOM_10950
  Lipid metabolism
   00600 Sphingolipid metabolism
    RHOM_10950
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RHOM_10950
Enzymes [BR:rho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RHOM_10950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AEN97299
UniProt: G2SXE2
Position
complement(2370582..2373761)
Genome map
AA seq 1059 aa AA seqDB search
MGEFLFERLSDPEYYEENRVAAHSDHVAYRNWDEADVWLDPLGRKSSFRLFLDGSWKFHY
ARNYEQTIHGFEKPEYDCRGWDDIRVPAHIQMEGYDSPQYANTQYPWDGREDVWTDEMPT
KFNPVASYVKYFTLPESFLGERVFISFQGAESGMALWLNGAYVGYSEDSFTPSEFELTPY
LKDGENKLAVQVFKWTIGSWCEDQDFFRFSGIFRSVYLYMIPKTHLCDIKIRPQVAENLS
CGTLELDLRSCGSGSVRIQLVERGRLDLAESRYETPEGTEVFALEEKMEGTLHVSREVAD
VKLWSAEEPYLYELRMEVYDAAGALQEVVASKIGFRRFEMKDGLMLLNGKRIVFKGVNRH
EFSSLTGRVVSMEETLTDVVTMKRNNINSIRTCHYPDNIGLYELCDIYGLYMIAENNMES
HGSWDAAAMRKIADPRTIVPGDNPKWEARMLDRVNSCYQRDKNHPAVLIWSCGNESYGGS
VIYQMSEKFRELDPDRLVHYEGVYNDRRYNGSSDMESQMYPPVERIVKNLAEQKEKPFIC
CEYTHAMGNSCGAMHKYTDLTDTEPRYQGGFIWDYIDQSITKKDRYGKEFQAYGGDFLER
PTDYNFSGNGICYAKGRAESPKMQEVKFNYQNISVSFTEDGFTVKNKNLFTDTAEYDCIL
LLEKNGVAAGRRKIALSVAPLSEKTFVLEELEGCMALADELEHAGKEAGAEYALTVSFVL
RGELLWAKPGHEIAFGQKIFAAKSPANGGTIGDAAAEYEGKCVTNRKAGLQIIRGKWNLG
VKGENFDVLFSYNSCGLVSYRYMGKELIEKIPMPNFWRAPIDNDCGSRMQGRMAQWKIAS
MYAGMSSKGMFDYEEPVVREAENSVSITYTYLLPTTPQAKCRVTYTVTPDAYVQTELTYD
PVEELGDMPEFGMLFKLNADYDRLEWYGLGPQETYADRRCGAKLGVYKNRVADNMAQYLV
PQECGNKVGVRYAKVTDARGRGMLFTGDELSFSALPYTPHELENAMHAYELPEVHYTVVR
VALAQMGIGGDDSWGAPVHPEYHIDVTKPLALRFGFRGI
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatttttgtttgagagattaagtgatccggaatattacgaggagaaccgcgtg
gcggcgcactccgaccatgtggcgtaccggaactgggatgaggcggacgtgtggctggat
ccgctcggaagaaagagcagtttccgcctgtttttagacggatcatggaaattccactat
gcgagaaactatgagcagacgatccatggatttgaaaagccggaatacgactgcagggga
tgggatgacatccgcgtgccggcacatatccagatggaaggctatgacagtccgcaatat
gcgaacacgcagtatccgtgggatggaagggaagacgtctggacggacgagatgccgacg
aagttcaatccggtcgcaagttatgtgaaatatttcacattgccggagtcctttttggga
gagcgtgtgtttatctcgttccagggagcggagagcggcatggcactctggctgaatgga
gcgtatgtcggatacagtgaggattcttttacgccgtccgagtttgaactgacgccttat
cttaaggacggggagaacaagctggcggtgcaggtattcaagtggacgatcggaagctgg
tgcgaggatcaggatttcttccggttttccggtattttccgcagcgtctatctctacatg
attccaaagacgcatctctgtgacattaagatccgtccacaggtggcggagaatctgtcc
tgcggcacgctggagctggatcttcgctcctgcggcagcggaagtgtgcgcatacagctt
gtggagcgcggaagacttgatctggcggagagccgctatgagacaccggagggcacggag
gtgtttgctctggaggagaagatggaaggaaccttacatgtctcgcgggaagtggcggat
gtgaagctgtggagcgcggaggagccgtatctgtatgaacttcggatggaggtgtatgac
gcggcgggcgctttgcaggaggtcgtcgcgtcgaagatcggcttccgtcggttcgagatg
aaggacggactgatgcttttaaacggaaagcggattgtgtttaagggcgtcaaccgccac
gaattcagttccctgaccggacgtgtggtgagcatggaggagacgctcaccgacgtcgtg
accatgaagcggaacaatatcaattccatccgtacctgccattatccggacaatatcgga
ctgtatgagctctgcgacatctacggactctacatgattgcagagaataatatggagtcg
cacggaagctgggatgcggcggcgatgcgtaagattgccgatccgcggacgattgtgccg
ggggataatccgaagtgggaggcaagaatgctcgaccgcgtgaattcctgctatcagcgg
gataagaaccatccggcggtcttaatctggtcctgcggcaatgagtcctacggcggaagt
gtgatttatcagatgtccgagaagttcagagagctggatcccgaccgcctggttcactac
gagggagtctataacgacagacgctacaacggaagcagcgatatggaaagccagatgtac
ccgccggtagagcggattgtgaaaaatctggcagagcagaaagagaagccgtttatctgc
tgtgagtacacgcacgcgatgggcaattcctgcggcgcgatgcacaagtacacagatctg
accgacacagagccgcgctatcagggcggatttatctgggattacatcgatcagtccatc
acgaaaaaggatcgctacgggaaggaattccaggcgtacggcggtgacttcttagagcgg
ccgacggactataatttcagcggcaacggcatctgctatgcaaaggggcgcgccgagtca
ccgaagatgcaggaagtaaaattcaattaccagaacatcagcgtatcctttaccgaagat
ggttttacggtaaaaaataaaaacctgtttaccgatacggcagagtatgactgcatcctt
ctgctggagaagaacggcgtggcggcaggccgcagaaaaatagcgctgtctgtggcaccg
ctctcggaaaagacgtttgttctggaagaactggagggctgcatggctcttgccgatgaa
ctggaacatgcgggaaaggaagccggggcggaatacgcactgaccgtatcgtttgtactg
cgcggagaactgctctgggcaaagccggggcatgagatcgcattcggacagaagattttt
gcggcaaaatcacctgcaaatggtgggacaatcggcgatgccgcggcagaatatgaagga
aagtgcgtgacgaaccgtaaggcgggacttcagatcatccgcggaaagtggaatctgggg
gtgaagggagagaattttgacgtactgttttcctacaacagctgcggactggtgtcctac
cgctacatgggaaaagagctgattgagaagataccgatgccgaatttctggcgtgcgccg
attgacaatgactgcggaagccgcatgcaggggcggatggcgcagtggaagatcgcgagt
atgtatgccggcatgagcagcaagggcatgttcgattatgaggaaccggttgtgagagag
gcggagaacagcgtctccatcacatatacctacctgcttccgaccacgccgcaggcaaaa
tgccgcgtgacctacaccgtgacgccggatgcgtatgtgcagaccgagctgacctatgac
ccggtggaggagctgggcgatatgccggagtttggaatgctttttaagctgaatgcggat
tacgacagactggagtggtacggacttggaccgcaggagacgtatgcggaccgcagatgc
ggcgcgaagctcggtgtatataagaaccgcgtggcggataatatggcgcagtatctggta
ccgcaggagtgcggcaacaaagtaggcgtgcgctacgcgaaggtgacggatgcaagagga
agaggcatgctctttaccggagacgaactgtcattttccgcactgccttatacaccgcat
gaactggaaaatgcaatgcatgcgtatgaactgcctgaggtacattacacggttgtccgt
gtggcactggcacagatgggcatcggcggagacgacagctggggagctccggttcatccg
gaatatcacattgatgtgacaaagccgttagcactgcggttcggtttccgtggaatataa

DBGET integrated database retrieval system