KEGG   Roseburia hominis: RHOM_10995Help
Entry
RHOM_10995        CDS       T01621                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rho  Roseburia hominis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rho00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2382825..2384825
Genome map
AA seq 666 aa AA seqDB search
MRTDHLLFGAAYYLEYLPYNRLETDMEMMERAGMNTIRIAESTWSTLEPSDGVFDFTCID
RMIQTAAKHHLSVIIGTPTYAIPTWLVRKYPDILAVTANGQELYGHRQNMDITHPGYRYH
AERIIRAMMEHLKDVPNIIGFQLDNETKSYGTAGPRVQQMFVASLKKKYPDILDFNREFG
LDYWSNRVNDWADFPDVRGTINQSLAAEFQRFQRSLVTEFLSWQSDIIKEYKRDDQFITQ
NFDFDWTDHSYGYQPEVDQYDAARCMTVAGADIYHPSQDDLTGAEITVCGNIARSLKKDN
YLILETEAQGLTPWLPYPGQLRLQAYSHLANGSNSVMYWHWHSIHNAIESYWKGVLSHDF
SENATYREASEIGAEWKRIGTHLMNLKKENRVAILLDNLSLAGLRQFPLETTGDHSYNAV
MRWLADALYRRNIEFDMVSSGERDFSAYDFLVVPALYAASDDLLGALDRYVAEGGHLIAT
FRTGFADEQLKIHHDVQPHLLGRCLGIHYDQFTYPKNVRIATTDGRSALTHDWMELVTCD
TATPLAHYDHPFWGSYAAVTENAYQKGSALYLGAFFDDELLEPLLVSYLSRHGYEGLSED
TPQFPLIVKRGTNDFGKNLCYYFNYSGEPRTVIHTGNAGTDLLTDTPVAAGAVLTLAPWG
LAVVES
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagatcacctgctctttggagcagcctactatctggaatatttgccgtataac
cgtctggagacagatatggaaatgatggagcgtgccggcatgaataccatccgcatcgcc
gagtccacctggagcaccttagagccgtccgacggcgtctttgactttacctgcatcgac
cgcatgatacagaccgccgcaaagcatcatctttccgtcatcatcggaaccccgacttac
gcgattccgacctggctggtgcgcaaatacccggatattctcgccgtcactgcgaacggg
caggagctctacggtcaccgtcagaacatggacatcacgcaccccggctaccgttatcac
gccgagcgcatcatccgcgccatgatggagcacttaaaggacgttccgaacatcatcggc
ttccagctggacaacgagaccaagagctacgggacggcaggtccgcgggttcagcagatg
ttcgtcgcttccctgaagaaaaaatacccggacattttggatttcaaccgtgaattcggt
ctggattactggagcaaccgcgtgaacgactgggcggattttccggatgtacgcggcacg
atcaaccagagtcttgccgcagaatttcagcgttttcagcgctccctcgtcacagagttc
ctctcctggcaatcggacattatcaaagagtacaaacgtgacgaccagttcatcacgcag
aattttgattttgactggaccgatcactcttacggctatcagccggaggtcgaccagtat
gacgccgcccgctgcatgaccgtagcaggcgccgatatttaccatccttcgcaggacgac
ctgaccggagctgagatcactgtatgcggaaatattgcgcgcagcttaaagaaggacaat
tatctgatcttagagacagaggcgcagggtctgaccccgtggctcccctatccggggcag
ctgcgcctgcaggcgtacagccaccttgcaaatggctccaacagcgtgatgtactggcac
tggcactcgatccacaatgcgatcgaaagctactggaaaggcgtgctttcccacgatttt
tccgaaaatgccacctaccgggaagccagcgaaatcggcgcggagtggaagcgcatcggc
acacacctcatgaatctgaaaaaggaaaaccgcgtcgccatcctgctggacaatctctcc
ctggcggggctgcgccagtttccgcttgagaccaccggtgaccacagctacaatgccgtg
atgcgctggcttgccgacgccctgtaccgcagaaacatcgagtttgacatggtctcttcc
ggcgagcgcgatttttccgcctatgattttctcgttgttccggcgctctatgccgcatcc
gacgatctcctcggcgcgctcgaccgctacgtggcagaaggcggacacctgatcgccact
ttccgcaccggcttcgccgacgaacagttgaaaatccaccacgacgtacagccacatctt
cttggtaggtgccttggcattcactacgaccagttcacctacccgaagaatgtccgcatc
gccaccacagacggcaggagcgccctcacacacgactggatggagcttgtcacctgtgac
accgcgacgccgctcgcgcattatgaccatccattctggggcagttatgccgccgtgacc
gagaacgcctatcagaagggctccgccctctacctcggcgctttcttcgatgatgaactg
ttggagccgctgctcgtatcctacctctccagacacgggtatgaaggtctttccgaagac
acaccgcagtttccgctgatcgtaaagcgcggcacaaacgattttggcaaaaatctgtgc
tactacttcaactattcgggagaaccgcggacagtgatccacaccggaaatgcgggcacc
gatcttttaaccgacaccccggttgccgccggtgccgtcctgacactggctccctggggg
ctggcggtcgtcgaatcatag

DBGET integrated database retrieval system