KEGG   Roseburia hominis: RHOM_11100Help
Entry
RHOM_11100        CDS       T01621                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rho  Roseburia hominis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rho00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rho00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2404577..2406088)
Genome map
AA seq 503 aa AA seqDB search
MKLSELCSEFKYECLSGSMDVDVRDVIYDSRKITEGTVFVCMVGAVTDGHKYIPDAVKKG
ASAIVVERADEAQQIPDQITVIQVESARRALAYMSAALFGHPDRKLVTIGITGTKGKTTT
TYMIKSVLEMAGKKVGLIGTIGAMIGDEHIPSKNTTPESYELHRMFAAMVEAGCEYVVME
VSSQGLKLDRTAGILFDYGVFTNLSPDHIGPAEHESFEEYLYCKSLLFRQCRVGIVNADD
PHWEEILKGHTCQVRTFSAEGNDVKDQVVDLFASDIGYINEGGRLGMHFTVSGCMDCKVK
VHIPGRFSVYNAMVTMLVCNLVGIPDRAVLDGLEKVQVKGRVEILPVSKDYSMIIDYAHN
EVSTRSVLTTLLEYHPKRLICVYGGGGNRSKLRRYDMGEVTGELADLCVLTCDNPRDEEI
RDINADIKVGLAKSNGKYIEIDDRKEAIAYCMTHAKPGDMIVLLGKGHEDYQEIKGVKYH
FDEREAVAEILDEIKSGERTVEA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagtgaactttgcagtgaattcaaatacgagtgtctctcgggaagcatggat
gtcgatgtgcgggatgtcatctatgattcccggaagattacagagggaacggtgtttgtc
tgcatggtgggagctgtgacggacggacataaatacatcccggatgcggtgaaaaagggt
gcgtcggcgatcgttgtcgagcgtgccgatgaggcgcagcagattccggatcaaatcacg
gtcattcaagtggaatcagccagacgtgcgcttgcctacatgtcggcggcgttgttcgga
catccggaccgtaagctggtcacgatcggcattacaggtacaaaaggaaagacgacgacg
acttacatgatcaagagcgtgcttgagatggcggggaagaaggtcggactgatcggaacg
atcggcgcgatgatcggtgatgagcacatcccatcgaaaaatacgacgccggagtcctat
gaacttcaccggatgtttgcggctatggtggaagccggatgcgagtatgtggttatggag
gtgtcctcgcagggattgaaactggaccgcacggcgggcatcttgtttgattacggcgta
tttaccaacctttccccggatcacatcggaccggcggagcatgagtcgttcgaggagtat
ctgtactgcaagagtcttctgttccggcagtgccgtgtcggcatcgtcaatgcggatgat
cctcactgggaggagattttaaagggacacacctgtcaggtgcgcacattttccgcagag
ggaaatgatgtgaaagaccaggtggtggatctgtttgcgtcggacatcggttatatcaac
gagggcggcagactcggcatgcattttaccgtgagcggctgcatggactgcaaggtaaaa
gtgcatattccgggcaggttttctgtgtacaatgcgatggtgacgatgctggtgtgcaac
cttgtcggtattccggaccgggcagtgctcgacggacttgagaaggttcaggtcaaaggg
cgtgtggagatccttccggtttcgaaggattattcgatgattatcgattatgcgcacaat
gaggtgagcacgagaagcgttttgacgacactcttagagtaccatccgaagcgcctgatc
tgtgtctatggaggcggtggcaaccgctccaagttaagacgctacgatatgggcgaggtg
accggagaacttgcagatctgtgcgttctgacctgcgataatccgcgcgatgaggaaatc
cgcgacatcaatgccgacatcaaggtcggtctggcaaaaagcaacggaaaatacatcgag
attgacgaccgcaaggaggcgatcgcctactgcatgacgcatgcaaagccgggggatatg
atcgtgctgctcggcaaggggcatgaggattatcaggagatcaagggtgtaaaatatcat
tttgacgagcgcgaagccgtagcggaaatcctggacgagatcaagtcgggagagcgcacg
gtcgaagcgtag

DBGET integrated database retrieval system