KEGG   Roseburia hominis: RHOM_11795Help
Entry
RHOM_11795        CDS       T01621                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rho  Roseburia hominis
Pathway
rho00900  Terpenoid backbone biosynthesis
rho01100  Metabolic pathways
rho01110  Biosynthesis of secondary metabolites
rho01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHOM_11795 (ipk)
Enzymes [BR:rho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RHOM_11795 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEN97467
UniProt: G2T422
Position
complement(2566645..2567517)
Genome map
AA seq 290 aa AA seqDB search
MKEISVKALAKVNLGLDVVRKRPDGYHEVRMIMQTIHLFDRLEITRNQSGRITMSTNLAF
LPTNENNLVYKAAALLKEEFDIGDGIDVKLHKHIPVAAGMAGGSTDAAAVLYGMNRIFDL
GLSKEDLMTRGVKLGADVPYCIMRGTALAEGIGEKLSALPPMVKCPVLIAKPQIGVSTKF
VYENLKLDADTVHPDIDGLIGAIRAKNLEQIAGHMGNVLETVTIPNYPVIAEIKDHMMEH
GAVHAMMSGSGPTVFGLFANGDTAVAAYEAMRESNLAKQVYLTSIYNNAR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatttcggtaaaagcactggcaaaagtaaatctcggacttgatgtggtacgg
aagagaccggacgggtaccatgaggtgcggatgatcatgcagacgattcatctgtttgac
cggctggagattacccgcaatcagtcgggcaggattacgatgtcgaccaaccttgcgttt
ctgccgacaaatgagaacaatctggtatacaaggcggcagcacttctcaaagaggaattt
gacattggggacggtattgatgtaaagctgcataagcacattccggtggcagccggcatg
gcaggcggaagcacggacgctgcggccgtattatatggaatgaaccgcatttttgatctg
gggctttctaaggaggatctgatgacgcgcggtgtgaagctcggcgcggatgttccctac
tgtattatgcgcggaacggcgctcgcggaggggatcggtgaaaaattatcggcgcttcct
ccgatggtcaaatgtccagtgctgattgctaagccgcagatcggggtttccacaaaattt
gtctatgagaatctgaagctggatgcggataccgtgcatccggatattgatgggctgatc
ggtgcgatccgggcgaagaatttggagcagatcgcaggacacatgggaaatgtgctggag
acagttacgattcccaattatccggtcattgcagagatcaaggatcatatgatggagcac
ggtgcagtccatgcaatgatgagcggaagcggtccaacggtctttggcctgtttgccaac
ggggatacagccgtggctgcatacgaggcaatgcgtgaatcaaatcttgcaaaacaggtt
tacctgacaagcatatacaacaatgcgcggtga

DBGET integrated database retrieval system