KEGG   Roseburia hominis: RHOM_14325Help
Entry
RHOM_14325        CDS       T01621                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rho  Roseburia hominis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rho00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RHOM_14325 (recR)
DNA repair and recombination proteins [BR:rho03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RHOM_14325 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3103485..3104081)
Genome map
AA seq 198 aa AA seqDB search
MEYYSRQISKLIQELSALPGIGTKSAQRLAFHILNMPKEQVEELSSAILDAKQNVRYCKE
CFTLTDEEICPICSDSSRNHKVIMVVENTRDLAAYEKTQKYDGVYHVLHGAISPMLGIGP
GDIKLKELMQRLQKDVDEVIIATNSSLEGETTAMYISKLIKPTGIKVTRIASGVPVGGDL
EYIDEVTLLRALEGRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaatactatagcagacagatcagcaagttaatacaggaattatccgccctgccggga
atcggcacgaagtctgcacagcgtctggcatttcatatcctgaatatgccaaaggagcag
gtggaggagctttcttctgcgattttggacgcaaagcagaatgtgcggtattgcaaggaa
tgttttacgctgacagatgaggaaatctgtccgatctgcagcgacagttccaggaaccac
aaggtcattatggtggtggagaacacgagggatctcgcggcatacgagaagacacagaag
tatgacggagtatatcatgtgctgcacggcgcgatctcacccatgctcggaatcgggccg
ggggacatcaaactcaaagaactgatgcagcgcctgcaaaaggatgtggatgaggtcatc
attgcgacgaattccagcctggagggggagacgacggcaatgtatatcagcaaactgatc
aaaccgaccggtataaaagttacgcggattgcaagcggtgtgccggtgggcggcgatctg
gaatatattgatgaggtgacgcttctgcgcgcgcttgaggggcgcacggaactgtag

DBGET integrated database retrieval system