KEGG   Roseburia hominis: RHOM_14790Help
Entry
RHOM_14790        CDS       T01621                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rho  Roseburia hominis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RHOM_14790
   00500 Starch and sucrose metabolism
    RHOM_14790
Enzymes [BR:rho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     RHOM_14790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3176529..3177527
Genome map
AA seq 332 aa AA seqDB search
MYTMTVAPGADVSGGFYSLKAAFAAMPEDPAVPVTIRVMPGIYHEKLSLTRPNVTIEGAG
ASPSDTVISFGDYGYEIMSDGIKRGTFRSYTFFVHAADVTLRNLTIENTAGDSKTHGQAI
ALYAECDRFVAEYCRILGHQDTLFTGPLPPEEYEPGGFRGPTESAPRINGRQYYHNCYIC
GDIDFIFGSATAYFEGCTIASLGPGYVTAASTPEGQEYGYVFHDCRFAAEGCPQHAAYIG
RPWRDYARVVLMDCAIGAHIHPAGFHDWGKEHAHGTVLFAEYHSYPQDADCGCADSCRPF
AQRADFVDTLDGAQAAHFSRELVLAGDDGWLP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaatgaccgttgcgccaggggcagatgtctctggcggcttttattcactgaaa
gcggcgttcgccgccatgccggaagatccggcggttcccgtgaccatccgcgtcatgccc
ggaatctaccacgaaaaattatccctcacacgcccgaacgtcacgatcgagggcgcagga
gcatccccgtccgacaccgtgatctccttcggcgattacggctacgagatcatgtcggac
ggcatcaagcgcggaaccttccgctcctacacctttttcgtgcatgccgcagacgttacg
ctgcgcaacttaaccatcgagaatactgccggcgactccaaaacgcacgggcaggcaatt
gcactctatgccgaatgtgaccgttttgtcgcggaatactgccggattctcgggcatcag
gatacgctttttaccggtccgcttcccccggaggaatacgagcccggcggctttcgcggg
ccgaccgagtccgcaccgcgcatcaacggcagacaatattatcacaactgctatatctgc
ggcgatatcgactttattttcggcagtgcgaccgcttactttgaaggctgtacgatcgca
tccttaggacccggatatgtcaccgccgcttccacccccgaagggcaggaatacggctat
gttttccacgactgccgctttgccgcggagggttgtcctcagcacgcggcctatatcggc
cgtccctggcgggattacgcacgggttgtcctcatggactgcgcgataggcgcccacatt
catcctgccggatttcatgactggggcaaggagcacgcacacggcaccgttctttttgcc
gagtatcacagttatccacaggacgctgactgtggctgtgcagacagctgccgcccgttt
gcacagcgtgcagactttgtggataccttagacggcgcacaggctgcccatttttccaga
gagcttgtgctggcgggggacgacggctggctgccgtga

DBGET integrated database retrieval system