KEGG   Roseburia hominis: RHOM_14790Help
Entry
RHOM_14790        CDS       T01621                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rho  Roseburia hominis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rho00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rho00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3176529..3177527
Genome map
AA seq 332 aa AA seqDB search
MYTMTVAPGADVSGGFYSLKAAFAAMPEDPAVPVTIRVMPGIYHEKLSLTRPNVTIEGAG
ASPSDTVISFGDYGYEIMSDGIKRGTFRSYTFFVHAADVTLRNLTIENTAGDSKTHGQAI
ALYAECDRFVAEYCRILGHQDTLFTGPLPPEEYEPGGFRGPTESAPRINGRQYYHNCYIC
GDIDFIFGSATAYFEGCTIASLGPGYVTAASTPEGQEYGYVFHDCRFAAEGCPQHAAYIG
RPWRDYARVVLMDCAIGAHIHPAGFHDWGKEHAHGTVLFAEYHSYPQDADCGCADSCRPF
AQRADFVDTLDGAQAAHFSRELVLAGDDGWLP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaatgaccgttgcgccaggggcagatgtctctggcggcttttattcactgaaa
gcggcgttcgccgccatgccggaagatccggcggttcccgtgaccatccgcgtcatgccc
ggaatctaccacgaaaaattatccctcacacgcccgaacgtcacgatcgagggcgcagga
gcatccccgtccgacaccgtgatctccttcggcgattacggctacgagatcatgtcggac
ggcatcaagcgcggaaccttccgctcctacacctttttcgtgcatgccgcagacgttacg
ctgcgcaacttaaccatcgagaatactgccggcgactccaaaacgcacgggcaggcaatt
gcactctatgccgaatgtgaccgttttgtcgcggaatactgccggattctcgggcatcag
gatacgctttttaccggtccgcttcccccggaggaatacgagcccggcggctttcgcggg
ccgaccgagtccgcaccgcgcatcaacggcagacaatattatcacaactgctatatctgc
ggcgatatcgactttattttcggcagtgcgaccgcttactttgaaggctgtacgatcgca
tccttaggacccggatatgtcaccgccgcttccacccccgaagggcaggaatacggctat
gttttccacgactgccgctttgccgcggagggttgtcctcagcacgcggcctatatcggc
cgtccctggcgggattacgcacgggttgtcctcatggactgcgcgataggcgcccacatt
catcctgccggatttcatgactggggcaaggagcacgcacacggcaccgttctttttgcc
gagtatcacagttatccacaggacgctgactgtggctgtgcagacagctgccgcccgttt
gcacagcgtgcagactttgtggataccttagacggcgcacaggctgcccatttttccaga
gagcttgtgctggcgggggacgacggctggctgccgtga

DBGET integrated database retrieval system