KEGG   Roseburia hominis: RHOM_15865Help
Entry
RHOM_15865        CDS       T01621                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rho  Roseburia hominis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHOM_15865
Enzymes [BR:rho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RHOM_15865
Exosome [BR:rho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHOM_15865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3377139..3379040)
Genome map
AA seq 633 aa AA seqDB search
MANFSELDRYLFGQATHYEIYRKLGAHPTDEYGIRGVCFDLWAPNAARVWVIGSFNGWDE
GANEMKRLEPETMGIFELFIPGVEEGDLYKYLIETKDGKRLYKADPYANYAELRPGTASA
VADIEHFKWSDAEWMKERATHKEDVYEQPLAIYEVHPGSWMRHPGRQDDGFYSYRDLAKS
LIPYVTEMGYSHIELMGICEYPYDGSWGYQVTGYYAPTSRYGTPEDFAYFVNECHRHKIG
VILDWVPAHFPKDAHGLAEFDGSCLYEYADPRKGEHPDWGTKIFDYGKNEVKNFLIGSAL
LWVEHYHVDGLRVDAVASMLYLDYGKEAGQWVPNQYGDNKNLEAIEFFKHINTLVLGRNP
GAVMIAEESTAWPKVTGPVEDDGLNFSYKWNMGWMHDFLDYMKLDPYFRRDNHHKMTFAM
SYNESEKYILVLSHDEVVHLKCSMINKMPGLGIDKFRNLMAGYAFMMGHPGKKLLFMGQE
FAQLREWSEERELDWFLLDNPDHKHIQNWVKKLLHIYRKNPALYELDSSWGGFEWINAND
ADRSIYSFIRKSKDGKNQLLFVCSFTPVARPDYRVGVPAKKTYKLILDSDSEEFGGCSRQ
RPQSYKAVEAECDGRPYSIAYPLEPYGVAVFRY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttttcagagctggatcggtacttatttgggcaggcgacacactatgagatt
taccggaagctgggggcgcatcccacagatgaatacggcatccggggagtctgctttgat
ctgtgggcgccaaatgccgcgcgtgtatgggtcatcggttcctttaacggatgggatgag
ggcgccaatgaaatgaagcgcctggagccggagacgatggggatttttgaattgtttatt
ccgggtgtcgaggagggcgatctgtacaagtacctcatcgagacgaaggacggaaagcgc
ctgtacaaggcagatccttatgcaaactacgcggagttaagacccggaacggcgtcggct
gttgcggatatcgaacattttaagtggtcagatgccgagtggatgaaagagcgcgccaca
cacaaggaagatgtatatgaacagccgcttgccatctatgaggttcacccgggatcctgg
atgcgtcatccgggcagacaggatgacggattttacagttatcgggatctggcaaaatct
ttgattccgtatgtgactgagatggggtattcccatatcgagcttatgggaatctgcgaa
tatccgtacgatggttcctggggctatcaggtaaccggttattatgcgcctacctcgcgc
tatggaacaccggaagacttcgcttattttgtaaatgaatgccacagacacaagatcggc
gtcatcttagactgggttccggcacattttccaaaggatgcgcacggtctggcagagttt
gacggaagctgtctctatgagtatgcagacccgagaaaaggggagcatccggactggggc
actaagatttttgattacggtaagaacgaggtcaagaatttcctgatcggcagcgccctg
ctgtgggtggagcattaccatgtggacggtctgcgtgtggacgcggtggcgtccatgctg
tatctcgattacggaaaggaagccggtcagtgggttccgaaccagtatggcgataataag
aacctggaagcaatcgagttctttaaacatatcaataccctggttctcggaagaaatccg
ggagctgtcatgattgcggaggaatctaccgcatggccgaaagtgaccggaccggtggag
gatgacggactgaatttcagctataagtggaacatgggctggatgcatgattttttggat
tacatgaagctggatccttactttcgacgggataatcatcacaagatgacatttgcgatg
agctacaatgagagcgaaaaatacattctggtgctctcccacgatgaggttgtacatctg
aaatgctccatgattaacaaaatgccgggacttggcattgataagttccgcaatctcatg
gcaggctacgcgtttatgatgggacatccggggaagaagcttttatttatgggacaggaa
tttgcacagcttcgcgagtggagtgaggagcgcgagctggactggttccttctcgacaat
ccggatcacaagcatatccagaactgggtgaaaaaactgcttcatatttaccggaagaat
ccggcgctttacgagctcgacagcagctggggcggtttcgagtggatcaatgcgaacgat
gcggacagaagcatctacagtttcatccgcaagagcaaggacggaaaaaatcagctgctc
tttgtgtgcagctttacaccggtggcaagaccggattacagagtgggagtgcctgccaag
aagacctacaagctgatattggacagtgactccgaagagtttggaggatgtagcagacag
cgtccgcagagttacaaggcggtggaggccgaatgtgacggcagaccatactcgatcgcg
tatcctctggagccgtacggcgtggcggtatttcgttactga

DBGET integrated database retrieval system