KEGG   Rhodococcus sp. WMMA185: BFN03_00805Help
Entry
BFN03_00805       CDS       T04814                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rhw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFN03_00805
   00630 Glyoxylate and dicarboxylate metabolism
    BFN03_00805
   00640 Propanoate metabolism
    BFN03_00805
   00650 Butanoate metabolism
    BFN03_00805
  Lipid metabolism
   00071 Fatty acid degradation
    BFN03_00805
   00072 Synthesis and degradation of ketone bodies
    BFN03_00805
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFN03_00805
   00310 Lysine degradation
    BFN03_00805
   00380 Tryptophan metabolism
    BFN03_00805
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BFN03_00805
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BFN03_00805
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BFN03_00805
Enzymes [BR:rhw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BFN03_00805
Exosome [BR:rhw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BFN03_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
215020..216408
Genome map
AA seq 462 aa AA seqDB search
MSKNSSQQVITPDPWRRSVTSKARTTSKSAAARKPRGKQQRPVAIVGGNRIPFARSDKAY
AQASNQDMFTATLDGLVSRFNLQGEKLGLVAGGAVLKHSRDFNLMRESVLGSALSPYTPA
FDLQQACGTGLASIVTVGDAIAAGRIDAGVGGGVDTTSDAPIGVNDELREFLLSLNRAKT
TGERIKLLGNVRPSMLGVEIPRNGEPRTGLSMGEHAAITAKEFGIRREDQDELAAASHKN
MAAAYDRGFFDDLVTPFLGLTRDDNLRPGSTVEKLATLKPVFGVKAGDATMTAGNSTPLT
DGASAVLLSSDEWAAERKLPVLAHLVDSETAAVDYIHGKDGLLMAPTYAIPRLLARNGLT
LQDFDFYEIHEAFASVVLATLQAFESEEYCKERLGLDGALGSIDRSKLNVNGSSLAAGHP
FAATGGRIVASLAKALAEKGSGRGLISICAAGGQGVTAIIEA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ctgagtaagaatagtagccaacaggtaatcacaccagatccttggagacgttcagtgacc
agcaaagctcgcaccacctcgaagtccgcagcagcgcggaagccacgcggaaagcagcag
cgtcccgtcgccatcgtcggcggaaatcgaattcccttcgcccgctccgacaaggcgtac
gcgcaggcgtccaaccaggacatgttcaccgcgaccctggacgggctggtgagccgcttc
aaccttcagggcgaaaagctgggcttggtagcgggtggcgccgtgctcaagcacagccgc
gacttcaacctgatgcgcgaatccgtgctcggtagcgcgttgagcccctacaccccggcg
ttcgacctgcagcaggcgtgcggcaccgggttggcgtcgattgtgaccgtcggtgatgcg
atcgcggccggacgtatcgatgccggagttggcggtggcgtcgacactacgtctgacgcc
ccgatcggcgtgaacgacgagcttcgcgagttcctgttgtcattgaaccgtgcgaagacg
actggcgaacgcatcaaactcctcggcaatgttcgcccctcgatgctcggcgtcgagatc
ccacgcaacggcgaaccccgcactgggctctcgatgggcgagcacgcagccatcacggcg
aaggagttcggcatccgccgtgaggaccaggacgaattggctgcggccagccacaagaac
atggccgccgcatacgaccgcggattcttcgatgatctggtgacgccgttcctgggcctc
acccgggacgacaacctgcgccccggctccaccgtcgagaagctggcgacgctgaagccg
gtgttcggggtaaaggcgggcgacgccacgatgacggcggggaactcgaccccgctcacc
gacggcgcgtctgcggtcttgctgtcgagcgacgagtgggctgccgagcgcaaactgccg
gtacttgcccatctcgtcgactccgagaccgcggccgtcgactacatccatggcaaggac
ggactcttgatggcgccgacgtacgccatcccgcgtctgctggcccgcaacggcctcacc
ttgcaggatttcgatttctacgagatccacgaagctttcgcatccgtcgtgctggcgacg
ctgcaggccttcgaatcggaggagtactgcaaggagaggctcggtctcgacggcgcactc
gggtctatcgatcggagcaagctgaacgtcaacggatcatcgttggcggcggggcacccg
ttcgctgcgacgggcggccgtatcgtcgcatcgctcgccaaggcgcttgccgagaagggg
tcaggacgtgggttgatctcgatttgcgcggccggcggacaaggtgtgacggcaatcata
gaggcgtga

DBGET integrated database retrieval system