KEGG   Rhizobium sp. N731: AMK02_PD00015Help
Entry
AMK02_PD00015     CDS       T04809                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhx  Rhizobium sp. N731
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rhx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMK02_PD00015 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    AMK02_PD00015 (vraB)
   00640 Propanoate metabolism
    AMK02_PD00015 (vraB)
   00650 Butanoate metabolism
    AMK02_PD00015 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    AMK02_PD00015 (vraB)
   00072 Synthesis and degradation of ketone bodies
    AMK02_PD00015 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMK02_PD00015 (vraB)
   00310 Lysine degradation
    AMK02_PD00015 (vraB)
   00380 Tryptophan metabolism
    AMK02_PD00015 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMK02_PD00015 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMK02_PD00015 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMK02_PD00015 (vraB)
Enzymes [BR:rhx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMK02_PD00015 (vraB)
Exosome [BR:rhx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMK02_PD00015 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
pRspN731d:13642..14841
Genome map
AA seq 399 aa AA seqDB search
MSYAYQPDEDWQPVVVAAYRTPIGRAFGSLSTVAAEDLLAPIIRRIVAETGVAPDAIDDV
LVGNAAGGGGNIGRLAALNAGLPMAVPGVAIDRQCGSGLEAIILAARLIQAKAGACFLAG
GVESVSTAPWRVERPKANCALPRFYGRARFSPETIGDPEMGVAAENVARQFGISRQRQDE
FALRSHRLAVKTAEAGLFRPEIVEIATAGGLVERDECPRPTTSLEALANLKPVFLVNGSV
TAGNACPVNDGACLVLVMSRDMARSLGIEKGLAFIDSAAAGVDPNLLGIGPVASTDKLLQ
RQPHLLLSKIDAIEFNEAFAAQVLASLDQLDISADAVNKEGGAMALGHPFGASGAILVTR
LYSQLIRGDGRRPAATGLAMIGIGGGIGLTALFEAVRLF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctacgcctatcagcctgacgaggattggcagccggtcgtggtcgccgcctaccgc
acgccgatcggccgggccttcggctcgctttcgacggttgcggccgaagatctgcttgcc
ccgatcattcgccggatcgtcgcggaaacgggcgttgcgcccgatgccatcgacgacgtg
ctggtcggcaatgccgccggcggcggcggcaatatcggccggctggcggcgctcaacgcc
ggcctgccgatggccgtccccggtgtcgccatcgatcggcaatgcggttccggcctagaa
gcgatcatcctggccgcccggctgattcaggcgaaggcgggtgcctgtttcctcgccggc
ggcgtcgaaagcgtcagcaccgccccatggcgcgtcgaaaggccgaaagccaattgcgcc
ctgccgcgcttttacggacgcgcgcgcttctcccccgaaacgatcggcgatcccgagatg
ggcgtcgccgccgaaaatgtcgctcgtcaattcggcatctcgcgccagcggcaggatgaa
ttcgccctgcgtagccacaggctggccgtcaagacggccgaggccggcctcttccggccg
gagatcgtcgagatcgccaccgccggcggcttggtggagcgggacgaatgtccgcgcccg
actacctcgcttgaggccctcgcaaacctgaagccggtcttcctcgtcaatggctccgtg
acagcaggcaatgcttgccctgtgaatgacggcgcctgcctggtgctcgtcatgagccgc
gacatggccagaagcctcggcatcgaaaaaggcctcgctttcatcgacagcgccgccgcc
ggcgttgatcccaacctcctcggcatcggcccggtcgcctcgacggataagcttctgcag
cgccagccccacctcttgctctcgaagatcgacgccatcgaattcaatgaggctttcgcg
gcgcaggttctggcgtcgctcgatcagctggatatatcagccgacgcggtcaacaaggag
ggcggcgccatggcgctcggccatcccttcggcgcctccggcgcgatcctggtcacccgg
ctctacagccagctcatccgcggggatggccggaggcccgccgccaccggcctcgccatg
atcggcattggtggcggcatcgggctcactgcgcttttcgaggctgtccgccttttctga

DBGET integrated database retrieval system