KEGG   Roseburia intestinalis M50/1: ROI_03490Help
Entry
ROI_03490         CDS       T02598                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rim  Roseburia intestinalis M50/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rim00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROI_03490
Enzymes [BR:rim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ROI_03490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328492..330105
Genome map
AA seq 537 aa AA seqDB search
MAKTLLKVANSLTKNVSSNKIITDTKKSEKNERKDRGRSLDAKRMARGAGILLAITSLPS
SYGIGTLGDAAFQFIDLLVDLKQRYWQVLPIGPTSFGDSPYQSYSAFAGNPYLIDLDDLV
QEKLLSVEEIRSFHWGNDEADIDYAMIYENRFKVLKMAFARFDIENEAFVRFCEENAGWL
SDYALYTALKKHFGDEEWQKWDEPLRSRDPEALKEYETTLHADILFYEFCQFEFFKQWKK
LKEYANNRGIQLIGDLPFYVALDSVDVWANRELFLLEEDGTPKGVAGSPPDAFSENGQKW
GSPVYNWSRMEEDGFAWWQARMLEHAKLFDVIRLDHFAAIVKYYVVPNKAEDGRSGKWSR
GPGKKLTDAIEKVIGDTHIIVEDIAGKSPIPGVKKLMARTGWPGIKILMFAFGDDTANEH
LPHNYTDCNLVVYAGTHDNETIVGYFRDKTDYELAYLYEYLNIKYKEEIPDALIRAAYAS
IADVVIIQMQDLMKLGNEARMNAPSTVGRNWRWRIGTDELSEERRAWIRTLASVYHR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacgctgttaaaagttgcaaattcgttgacaaaaaacgtttccagtaataaa
attatcacagatacgaaaaaaagcgaaaaaaatgagaggaaggaccggggaagatcattg
gatgcaaaaagaatggcaaggggagcaggaatcctcttagcgatcacaagtttaccatct
tcatacggaattggtacattaggagatgcggcattccagtttatagatctgctggtggat
ttaaaacagcgttactggcaggtgctgccgatcggtccaaccagttttggagacagtcca
tatcagtcatattccgcatttgccgggaatccatatctgatcgatctggatgatcttgtg
caggagaagctgcttagtgtggaagagatccgaagtttccattggggaaatgatgaagcg
gatattgattatgcgatgatttatgagaaccgctttaaagttttgaaaatggcgttcgca
cgattcgatatcgaaaatgaagcttttgtaaggttctgtgaagaaaatgccggatggctt
tctgattatgcactttatactgcattaaagaaacattttggtgatgaggaatggcagaag
tgggacgaaccgcttcgaagccgggatcctgaggcattaaaagagtatgaaacaacgtta
catgcagacatattgttctatgaattctgccagtttgaattttttaaacaatggaaaaaa
ttaaaagaatatgcaaataacagaggtatccagctgattggtgatcttccgttttatgtg
gcattagacagtgtggatgtatgggcaaaccgggaacttttcttattggaagaggatggg
acgccaaaaggagttgcaggttctccgccggatgcattttcagagaatggacaaaagtgg
ggaagtccggtatacaactggagccggatggaagaagatggatttgcctggtggcaggcg
cgtatgttagaacatgcaaagctgtttgatgtaatacggcttgatcattttgcagcgatc
gtaaagtattatgtcgtaccgaacaaggcagaagatggaagaagtggaaagtggagtagg
ggacctggaaagaaacttacggatgcaatcgaaaaagtgatcggagatacacacatcatc
gttgaggatatcgcaggaaagagtccgataccgggtgtgaagaagctgatggcaagaacc
ggatggccgggcatcaagattttgatgttcgcatttggggatgatacggcaaacgaacat
cttccacataattacaccgactgcaatcttgtcgtttatgcgggaacgcatgacaatgaa
acaattgttggttacttcagggacaaaacagattatgagcttgcttatctgtacgagtat
ctgaatatcaaatataaagaagaaataccggatgcgctgatccgggctgcctatgcaagc
attgcagatgtggtgatcatacagatgcaggatctgatgaagcttggaaatgaagcgcgg
atgaatgcaccatccaccgtcgggagaaactggagatggaggattggaaccgatgaactg
agtgaggagcgaagggcatggatccggacacttgcatcagtttatcacagatga

DBGET integrated database retrieval system