KEGG   Roseburia intestinalis M50/1: ROI_13770Help
Entry
ROI_13770         CDS       T02598                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rim  Roseburia intestinalis M50/1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rim00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1386240..1386968
Genome map
AA seq 242 aa AA seqDB search
MELSYKEIRAQICDVCHKMWQLGWVASNDGNVSVKLSDGTFLATPTGVSKSMVTPEMIVH
INKAGEVIEAADGYRPSSEMRMHFRCYEEREDVGAVLHAHPPVATGFAVADIPLDEYSMI
ETVLALGSVPIAPYATPSTDEVPDAITPYLQEHDAILLKNHGAVTVGADVYTAYYRMETL
EQFAKITLTAHLLGGAKEIDRENIDRLVDLRNNYYKMSGKHPGYKKYSGESHFAPQKKED
RR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaactcagttataaagaaatcagagcacagatctgtgatgtgtgccataagatgtgg
cagcttggatgggttgcatcaaatgacggaaatgtgtcggtaaaactttccgatggcaca
tttttagcaacgccgaccggcgtgtcaaaaagtatggtaacaccggaaatgatcgtgcat
ataaataaagcaggagaggtgatcgaagctgcggacggataccgcccgtcgtccgaaatg
cggatgcatttcagatgttatgaggaacgtgaagatgtcggcgcggtattacatgcacat
cctccggttgcaacgggatttgctgtggcagatattccgcttgatgagtattccatgatc
gagactgtgctcgcacttggttcagtgccgattgcgccttatgcgacaccttccacagat
gaggtgccggatgccattaccccgtatctgcaggaacatgatgcaatcctgttgaaaaat
catggagcggtaacagttggagccgatgtttatacggcgtattaccggatggaaacgtta
gagcagtttgcgaaaataacactgacggcacatctgctcggcggtgcaaaagaaattgac
cgggaaaatatcgaccggcttgtggatcttagaaacaattattataaaatgagtggaaaa
catccggggtataagaaatatagtggtgagtcgcattttgctccgcaaaaaaaggaggat
cgcagatga

DBGET integrated database retrieval system