KEGG   Roseburia intestinalis M50/1: ROI_26720Help
Entry
ROI_26720         CDS       T02598                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rim  Roseburia intestinalis M50/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rim00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2686478..2688019)
Genome map
AA seq 513 aa AA seqDB search
MRTSGVLMHISSLPSPYGIGTMGKEARKFADFLKKAGQKYWQILPICPTSYGDSPYQSFS
SFAGNPYFIDLEYLCKEKLLTKKECESFSWGTNPQYVDYGQMYVSRYPLLKKAYDRFRKN
EPEDFAAFCKDEAEWLDEYALFMALKDANGGVAWYEWEKDLKTRKTEALKEARVTYAEDI
AFYKMLQYLFFKQWWDLKAYVNDLGIEIIGDVPIYVAGDSADVWADPGQFYLDEELNPID
VAGCPPDAFSADGQLWGNPLFRWDAMKKDGYSWWTKRVKAMSKLYDIVRIDHFRGFDSYY
AIPAKDDTARNGEWRKGPGMDLFRTMEKKLGKLNIIVEDLGFLTPSVLKLVKDSGFPGMK
VIQFAFDSREGSDYLPHNYEKHCVVYTGTHDNDTLMGWMKTAPKASVKFAKEYLNLTEEE
GFNWGMMRAAWASVGDMAIVPMQDLIGIGSEGRMNTPSTLGGNWEWRATSDQITGKLAKR
LYKYMEMYGRLNKDQEEEEETEAEEKKVSAEEK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccagcggtgtgctgatgcacatatcttccctgccgtctccttacggaatcggt
accatgggaaaagaagcaagaaaatttgcagattttttgaaaaaggcaggtcagaaatac
tggcagatcctgccaatctgtccgaccagctacggagattccccgtatcagtctttttcc
agctttgcaggtaatccttattttattgatttagaatatctttgcaaagaaaaattactg
acaaaaaaagaatgtgaatcattttcgtggggaaccaatccgcagtatgtggattatggt
cagatgtatgtctcacgttatcctttgttaaagaaagcatatgacaggttcaggaaaaat
gagccggaagattttgcagcattctgcaaggatgaagcagagtggttggatgaatatgca
ctttttatggcattaaaagatgctaacggcggtgttgcatggtatgagtgggaaaaagac
ttaaaaaccagaaaaacggaagccttaaaagaagcgcgggttacctatgcagaagatatt
gcgttttataaaatgttacagtatctgttctttaaacagtggtgggatttaaaagcgtat
gtcaatgatcttggcattgagatcatcggtgacgtgccgatctatgttgccggagacagt
gctgatgtctgggcagatccgggacagttttatctcgatgaggagttaaatccgatcgat
gtagcaggctgcccgccggatgcattctcggcagacggacagctctggggcaatccgtta
ttccgctgggatgctatgaaaaaagacggttacagctggtggacgaagcgtgtaaaagcg
atgtcaaaattatacgatatcgtccgtatcgatcatttccgcggtttcgattcttactat
gcgatcccggcaaaagatgatacggcgagaaatggtgagtggagaaaaggtcctggcatg
gatctgttccgtacgatggagaaaaaactcggaaagttaaatatcatcgtggaggatctt
ggtttccttacaccttccgttttaaaactggtaaaagattccggtttcccgggaatgaag
gtcatccagttcgcatttgattcaagagagggcagtgattatctgccacacaactatgag
aaacattgtgtcgtatataccggaacacatgacaatgatacgttgatgggctggatgaag
acagcaccgaaggcaagtgttaaatttgcgaaagagtacttaaatctcacggaggaagaa
ggttttaactggggtatgatgcgcgctgcatgggcatcagtcggagatatggcgatcgtt
ccgatgcaggatctgatcggaatcggttccgagggacgtatgaatacaccgtccacactc
ggcggtaactgggagtggagagcaacttcagaccagatcaccggaaaacttgcaaaacgt
ctctataaatatatggagatgtatggacgtttaaacaaagatcaggaagaggaagaagaa
accgaagcggaggagaagaaagtatccgcagaggaaaaataa

DBGET integrated database retrieval system