KEGG   Roseburia intestinalis M50/1: ROI_26950Help
Entry
ROI_26950         CDS       T02598                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rim  Roseburia intestinalis M50/1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rim00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ROI_26950
  Lipid metabolism
   00561 Glycerolipid metabolism
    ROI_26950
   00600 Sphingolipid metabolism
    ROI_26950
Enzymes [BR:rim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ROI_26950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2705961..2708369)
Genome map
AA seq 802 aa AA seqDB search
MITVENQLFSLHTRHTSYLFRVMETGHLEHLYYGRKIHPAIDGLMEQHAFAPGNTNIYDS
EHLQFSLEDACLEMSSFGKGDIREPFVELTLSDGSETSDFLFEKFEQGTGKEEFETLPGS
YDESGEVEWLGVTLRDKNSGVILELHYYVYEDCDVITRSAKLINESGDVVKLNRLMSLQI
DLEPSDYVFTTFHGAWAREMGRTDVRLVPGKYVNASYTGTSSSRDNPFVMLGKEHTTEDA
GECFGFNLIYSGNHYEAAEVGSFGKVRIVSGINPQSFCFTLESGESFEAPEAVMTYASDG
YNAMSQNMHRFVREHIVRGTWKKKERPVLLNSWEAAYFDINERKLLSLAKAGKEAGIELF
VMDDGWFAKRDNDTRSLGDWQPNPKKLPGGLKGIADKIRAIGMDFGIWVEPEMVNVDSNL
YRSHPDWVIEIPGKAHSEGRNQRILDLTRKDVQDHIIEEMGRVFSSADISYVKWDMNRTF
SDYFSQSIRPERQGEVAHRYVMGLYRCMRELTKRFPDILFEGCAAGGNRFDLGMLCYFPQ
IWASDDTDALCRAEIQTGYSYGYPMSVISAHVSGCPNHQTLRTTPLETRFAVAAFGLLGY
ECNFCDLKKEESEAIKAQIILYKKWRSVLQQGIFYRGRSFTGNGRGNAFGKNSVLWNDDS
NVTEWTCVSPDQSKAVGFVMQKLVVPNTQFGYYKPQGLCEEKKYHFYNRSLKYNVKEFGD
LVNTVSPIHIRQDSIAHNLVAKFVKMDGEKENITAYGDTLMYGGVKLKPAFSGNGYNENV
RYFQDFGARMYFMEEAFEDHAL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagtcgaaaaccagttattttccctgcataccagacatacttcttatctgttc
cgtgtcatggaaaccggacatttggagcacttatattatggaagaaaaattcatccagcc
atagacggattgatggaacagcatgcatttgcgccgggcaataccaatatttatgacagt
gaacatctgcagttttccttagaggacgcatgtcttgagatgtcctctttcgggaaaggc
gatatcagggagccttttgtggaactgacactttccgatggaagcgaaacgtctgatttc
ctgtttgaaaaatttgaacagggaaccggaaaggaagaatttgagacacttccgggatcg
tatgatgagtccggtgaggtggagtggcttggtgtgacactgcgcgataaaaacagcgga
gtcatattagaactccattattatgtctatgaggactgtgatgtgatcacaaggagcgca
aaactcatcaatgagagcggggatgtggtaaagttaaaccgcctgatgagcctgcagatt
gatttagaaccgtccgactatgtgtttacaacatttcacggggcttgggcacgtgaaatg
gggcgcacggacgtacggctggtgccgggaaaatatgtaaacgcctcttacacgggaacg
tcgtcgagccgtgacaatccgtttgtgatgcttggaaaagaacataccacggaggatgcg
ggggaatgttttggatttaatctgatctacagcggcaatcactatgaggcggcggaggtc
ggcagttttggaaaagtaagaatcgtatccgggatcaatccgcagtcgttctgttttaca
cttgagtcaggggagagttttgaggcgccagaggcggtaatgacctacgcatcagacgga
tataatgccatgagccagaatatgcaccgttttgtgcgggagcacattgtgaggggaacc
tggaagaaaaaggagcgcccggtgctcttaaacagctgggaggcagcctattttgacatt
aatgaaagaaaactgctctcacttgcaaaagcgggaaaagaggcgggcattgagcttttc
gtcatggatgacggctggtttgcgaaacgtgataatgacacgagatcgttaggagactgg
cagccaaatccaaagaaactgccgggcggtttaaaggggattgcagataagatcagggcg
attggcatggattttggaatctgggtggagcctgagatggtcaatgtggacagtaatctc
taccgcagccatccggactgggtgatcgagattccgggaaaggcgcactcggaagggcgc
aatcagaggatccttgatctgaccagaaaggacgtgcaggatcatatcattgaggagatg
ggcagagtattttcctccgcggacatttcctatgtaaaatgggatatgaaccgcacattt
tcggattatttttcacagagtatccgtcctgaaaggcagggggaggtggcacaccggtat
gtgatgggactttaccgctgcatgagggagctgacaaagagattcccggacatcctgttt
gagggctgtgctgcgggtggaaaccgttttgaccttggtatgctctgctatttcccacag
atctgggcgagcgatgatacagatgcgctctgccgtgccgagatccagaccgggtacagc
tacggctacccgatgtccgtgataagcgcacatgtctccggctgcccaaatcatcagaca
ctgcgcacgacaccgcttgaaacacgttttgcggtagcggcgtttggactgctcggatat
gagtgcaatttctgtgatctgaaaaaagaagagtcagaagccatcaaagcgcagatcatt
ctttacaaaaaatggcgcagtgtgctgcaacagggaattttttaccgtggcaggagtttt
acagggaacggcagaggaaatgcgtttggaaaaaacagtgtcctctggaatgatgacagc
aatgtgacggaatggacgtgcgtctcgccggatcagtcgaaggcggtcggcttcgtcatg
caaaagcttgtcgtgccaaacacgcagttcgggtactataaaccacagggactctgtgag
gaaaagaagtatcatttttataaccgttctttaaaatataatgtcaaagagttcggggat
ctggttaacaccgtatcaccgatccatatcagacaggactccattgcgcacaatctggtt
gcaaagtttgtgaaaatggacggggaaaaggagaatattacggcatacggggataccctg
atgtatggcggcgtgaagttgaaaccggcattttccggcaatggatataatgagaatgtg
agatattttcaggatttcggggcgcggatgtattttatggaagaggctttcgaagatcat
gctctatga

DBGET integrated database retrieval system