KEGG   Roseburia intestinalis M50/1: ROI_34590Help
Entry
ROI_34590         CDS       T02598                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rim  Roseburia intestinalis M50/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rim00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROI_34590
Enzymes [BR:rim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ROI_34590
Exosome [BR:rim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROI_34590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3464612..3466510
Genome map
AA seq 632 aa AA seqDB search
MANFSELDRYLFGQATHYEIYRKLGAHFTDQYGIRGVCFDVWAPNAARIWVIGSFNGWDE
TADEMTRLEPDTMGIFELFIPGIEEGALYKYLIETKDGKRLYKADPYANYAELRPGTASA
VTDIEHFKWTDEKWMEERAKTKDIYAKPMAIYEVHPGSWMRHPGREDDGFYSYRDLVKYL
IPYVKEMGYTHIELMGISEYPFDGSWGYQVTGYYAPTSRYGTPQDFAYFINECHKHKISV
ILDWVPAHFPKDAHGLAEFDGTCLYEYADPRKGEHPDWGTKIFDYGKNEVKNFLIGSALM
WIEHYHIDGLRVDAVASMLYLDYGKQPGQWVPNKYGDNKNLEAVEFFKHVNTLILGRNPG
AVMIAEESTAWPKVTGRVEDDGLNFSYKWNMGWMHDFLDYMKLDPYFRKDNHHKMTFAMS
YNESEKYILVLSHDEVVHLKCSMINKMPGEMEDKFKNLMVGYAFMMGHPGKKLLFMGQEF
AQLQEWSEARELDWYLLENPDHKHMQNWVKKLLHIYQKNPALYELDSSWGGFEWINANDA
ERSIFSFIRKSKDGKNNLLFVCNFTPVERSDYRVGVPKHKTYKLILNSDDAEFGGSGKER
PVNYKSVSKECDGRPYSFAYPLPGFGVAVFRY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggctaatttttcagagttggatcgctatttatttggacaggcgacgcattacgagatt
taccggaaactgggggctcattttacggatcaatatggaattcgtggagtatgttttgat
gtgtgggctccgaatgccgcaagaatatgggtgattggttcttttaacggatgggatgaa
acggcagatgaaatgacaaggttagagccggataccatgggaatattcgaattgtttatt
ccggggatcgaggaaggtgcactgtataaatacctgatagagacgaaagatggaaaacgg
ctctataaggcggatccatatgcaaattatgcagagcttcgtccgggaacggcatctgcc
gtcacggatatagagcattttaagtggaccgatgaaaaatggatggaagagcgtgcaaag
accaaagatatctatgcaaaacctatggcgatctacgaggtacatccgggatcctggatg
cgccatccgggcagagaggatgacggattttacagttatagggatcttgtgaaatatctg
atcccgtatgtgaaggagatgggatatacacatattgagctgatgggtatttctgagtat
ccgtttgacggttcctggggatatcaggtaaccggttattatgcaccgacttcccgttat
ggaacgccgcaggattttgcatattttatcaatgaatgtcacaagcacaagatcagtgtg
atcctagactgggtgccggcgcatttcccgaaagatgcacatggactggctgagtttgat
ggaacatgtctgtatgaatatgcggatccaagaaaaggagaacatccggactggggtaca
aagatatttgattacggcaagaatgaagtaaagaatttcctgatcggcagtgcattgatg
tggatcgagcattatcatattgacgggctgcgtgtggatgcagtggcatctatgttatat
ctggattatggaaagcagccgggacagtgggttccgaataaatacggtgataataagaat
cttgaggcagtggagttttttaagcatgtcaatacactgatccttggaagaaacccggga
gcagtcatgatcgctgaggaatctacggcatggccgaaagtcaccggccgtgtggaagat
gacggactgaatttcagttataaatggaatatgggatggatgcatgatttcctggattat
atgaaacttgatccgtatttccgcaaagataatcaccacaaaatgacttttgccatgagt
tataacgagagtgagaaatacattcttgtgctttcccatgacgaagtggtacatctgaaa
tgttccatgatcaataagatgccgggcgagatggaagataaatttaaaaatctgatggtc
ggctatgcgtttatgatgggacatcctggcaaaaaacttctgtttatgggacaggaattt
gcacagcttcaggagtggagtgaggcgagagaattagactggtatctgctggaaaacccg
gatcataagcatatgcagaactgggtaaagaaattattacatatttatcagaaaaatccg
gcactctatgaacttgacagcagctggggtggatttgaatggatcaatgcaaatgatgct
gagcgcagtattttcagctttatcagaaagagcaaagacggaaagaataatctgcttttt
gtatgcaattttacaccggtggaacgcagcgactaccgcgtaggcgtaccaaaacacaag
acttataaactgattttaaacagtgacgatgcagaatttggcggaagcggcaaagagcgt
ccggtaaattataaatctgtgtcgaaggaatgtgatggaagaccatactcgtttgcatat
ccgcttccgggctttggtgtggcagtattccgctattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system