KEGG   Candidatus Riesia pediculicola: RIEPE_0034Help
Entry
RIEPE_0034        CDS       T01218                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIEPE_0034 (pfkA)
   01230 Biosynthesis of amino acids
    RIEPE_0034 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIEPE_0034 (pfkA)
   00030 Pentose phosphate pathway
    RIEPE_0034 (pfkA)
   00051 Fructose and mannose metabolism
    RIEPE_0034 (pfkA)
   00052 Galactose metabolism
    RIEPE_0034 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    RIEPE_0034 (pfkA)
Enzymes [BR:rip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RIEPE_0034 (pfkA)
Protein phosphatases and associated proteins [BR:rip01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RIEPE_0034 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28645..29649
Genome map
AA seq 334 aa AA seqDB search
MMNRGKIKRIGILTSGGDAPGMNAAIRSVVKMSISQGLEIYGIHDGYMGLYENRIEKLNN
GLVSDIISKGGTFLGSARFPEFKRSEEIRNQAVNNMKKNGIDALIVIGGDGSYRGAKKII
DYGFPCIGIPGTIDNDVAGTDYTIGYFTALNTIVEAIDRLRDTSTSHKRISIVEIMGRYC
GDLTLSATIAGGCEFVVLPEIPFDKKKLLEEIKYGLLKGGGRHAIVAITEYIYDVNKLAK
HIEKETGHETRATILGHVQRGGKPVACDRVLASRMGAYSVELLLKGYGSHCIGIRNDQLI
YQEISEALEGTKKRFKYDWLKIIKMLNWSENSYR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcgaggaaaaataaaaagaataggaattttaacaagtggaggagatgcgcct
ggaatgaacgctgcgattcgaagcgtagttaagatgagcatctctcaaggtttagaaata
tatggaattcatgatggttacatgggtctttatgagaataggattgaaaagttaaataat
ggattagtttcagatattattagtaaaggaggaacatttttaggatcagctcgatttcct
gaatttaaaagaagcgaagaaatccgaaatcaagcagtaaataacatgaaaaaaaatgga
atagatgctttgattgttataggaggagatggatcgtatagaggtgcaaaaaaaatcatt
gattatggttttccttgcattggaattcctggaaccatcgataatgatgttgctggaacc
gattatactataggatatttcactgctcttaatactatagtagaagccatagatcgacta
agagatacttctacttcacataaaagaatatctatcgttgaaataatgggacgatattgc
ggagatctcactttatctgcaaccattgctggaggttgcgagtttgtagttttgccagaa
attccattcgataaaaaaaaactattagaagaaatcaaatatggtcttttaaaaggagga
ggaagacatgcaattgttgcaattacggaatatatatacgacgtaaataaattggccaaa
catatcgaaaaagaaactggtcatgaaacaagagctacgatactcgggcatgttcaaaga
ggaggaaaaccagtagcatgtgatcgagttcttgcatctagaatgggagcatattctgtg
gaacttcttttgaagggatatggaagtcattgcattggtattcgaaatgatcaattaatc
tatcaggaaatttctgaagcattagaaggaacgaaaaaaagattcaaatacgattggttg
aaaattattaagatgttaaactggtcagaaaactcgtatcgataa

DBGET integrated database retrieval system