KEGG   Candidatus Riesia pediculicola: RIEPE_0114Help
Entry
RIEPE_0114        CDS       T01218                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00010  Glycolysis / Gluconeogenesis
rip00020  Citrate cycle (TCA cycle)
rip00620  Pyruvate metabolism
rip01100  Metabolic pathways
rip01110  Biosynthesis of secondary metabolites
rip01120  Microbial metabolism in diverse environments
rip01130  Biosynthesis of antibiotics
rip01200  Carbon metabolism
Module
rip_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIEPE_0114
   00020 Citrate cycle (TCA cycle)
    RIEPE_0114
   00620 Pyruvate metabolism
    RIEPE_0114
Enzymes [BR:rip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RIEPE_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADD79894
UniProt: D4G7S5
Position
109585..110871
Genome map
AA seq 428 aa AA seqDB search
MFIDIRIPEIGVDEVEITDVLVKVGEKVKLDQPLISIEGEKVSLELPSPNSGIVKEIKIL
KGEIVKKGTLVMVLEDHSNQKELICSNPKKNDQNQLEKVKSIDHIERKFINDRNLNDINE
KNQVILHATPVVRRLARKFNVNLNNVKGSGRRNRILPEDILKYVKKAVEKFDLFSKNKKE
TSLDQEGELNKKIEIPKTLKMNRIQRSSCKKLSETWAMVPHVTVFGEIEVTELESFRKLY
NKRLEKCENSFKMTMLPFFLKAVSKIMKDFPIFNSKISDNFQEIEIKKEINVGFAVDTNQ
GLLVPIIKNVDQIGIFEISKMIIKLSEKARLGKLSLEDMRGGGFTISNLGSTGKNVGFFT
PIINSPEVAILGISRSFMKPVWNGSSFLAKLTVPISLSFDHRVINGADGAKFLDQVSFLI
QDLRNLLM
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgatattcgaataccagaaattggagtagatgaagttgaaataactgacgtt
ttggtcaaggtaggtgaaaaagttaaactcgatcaacctttgatatcaatagaaggagag
aaagtatcattggaacttccctctccaaattctgggatcgttaaagagatcaaaatattg
aaaggagaaattgtcaaaaaaggaacattagtaatggttcttgaggatcatagtaatcaa
aaagaactaatttgttcaaatccgaagaaaaatgaccaaaatcaattagaaaaagtaaag
agcatagatcatatagaacgtaaatttattaatgacagaaatttaaatgatataaatgaa
aaaaatcaagttattttacatgccactccagttgttagaagattagctagaaaatttaat
gtcaatttaaacaatgtcaaaggatctggaaggagaaatcgaattcttccggaagatatt
ttaaaatatgtaaagaaagcagttgaaaaatttgatttattttctaaaaataaaaaggaa
acttcattagatcaagaaggtgaattgaacaaaaagatagagattcctaaaactttgaag
atgaatcgtatccaaagaagttcctgcaaaaaattatctgaaacttgggctatggttcct
catgtcacagtttttggagaaatagaagttacagaattagaatcttttagaaagctatac
aacaaaagattagaaaaatgtgaaaattctttcaagatgacgatgttacctttcttttta
aaagctgtttctaaaataatgaaagattttccaatttttaatagtaaaatatcagacaat
tttcaagaaattgaaataaagaaagaaattaatgtaggattcgcagttgacacaaatcaa
ggacttttggtgccaattatcaagaacgtggatcaaataggaatatttgagatatctaag
atgataatcaaattatctgaaaaagcaagattaggaaaattgtccttagaggatatgaga
ggaggaggatttacgatttcaaatcttggaagtacaggaaaaaatgttggattctttact
ccaattataaactcaccagaagtagcaattttaggaatttctcgatcttttatgaagcct
gtttggaatggttcgagctttctagccaaattaacagtaccgatatctttatcttttgat
catagagtgattaatggagcggatggagcaaaatttttagaccaggtgtcttttttaata
caagatcttagaaacttgctaatgtag

DBGET integrated database retrieval system