KEGG   Candidatus Riesia pediculicola: RIEPE_0114Help
Entry
RIEPE_0114        CDS       T01218                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rip01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rip00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rip00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rip00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109585..110871
Genome map
AA seq 428 aa AA seqDB search
MFIDIRIPEIGVDEVEITDVLVKVGEKVKLDQPLISIEGEKVSLELPSPNSGIVKEIKIL
KGEIVKKGTLVMVLEDHSNQKELICSNPKKNDQNQLEKVKSIDHIERKFINDRNLNDINE
KNQVILHATPVVRRLARKFNVNLNNVKGSGRRNRILPEDILKYVKKAVEKFDLFSKNKKE
TSLDQEGELNKKIEIPKTLKMNRIQRSSCKKLSETWAMVPHVTVFGEIEVTELESFRKLY
NKRLEKCENSFKMTMLPFFLKAVSKIMKDFPIFNSKISDNFQEIEIKKEINVGFAVDTNQ
GLLVPIIKNVDQIGIFEISKMIIKLSEKARLGKLSLEDMRGGGFTISNLGSTGKNVGFFT
PIINSPEVAILGISRSFMKPVWNGSSFLAKLTVPISLSFDHRVINGADGAKFLDQVSFLI
QDLRNLLM
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgatattcgaataccagaaattggagtagatgaagttgaaataactgacgtt
ttggtcaaggtaggtgaaaaagttaaactcgatcaacctttgatatcaatagaaggagag
aaagtatcattggaacttccctctccaaattctgggatcgttaaagagatcaaaatattg
aaaggagaaattgtcaaaaaaggaacattagtaatggttcttgaggatcatagtaatcaa
aaagaactaatttgttcaaatccgaagaaaaatgaccaaaatcaattagaaaaagtaaag
agcatagatcatatagaacgtaaatttattaatgacagaaatttaaatgatataaatgaa
aaaaatcaagttattttacatgccactccagttgttagaagattagctagaaaatttaat
gtcaatttaaacaatgtcaaaggatctggaaggagaaatcgaattcttccggaagatatt
ttaaaatatgtaaagaaagcagttgaaaaatttgatttattttctaaaaataaaaaggaa
acttcattagatcaagaaggtgaattgaacaaaaagatagagattcctaaaactttgaag
atgaatcgtatccaaagaagttcctgcaaaaaattatctgaaacttgggctatggttcct
catgtcacagtttttggagaaatagaagttacagaattagaatcttttagaaagctatac
aacaaaagattagaaaaatgtgaaaattctttcaagatgacgatgttacctttcttttta
aaagctgtttctaaaataatgaaagattttccaatttttaatagtaaaatatcagacaat
tttcaagaaattgaaataaagaaagaaattaatgtaggattcgcagttgacacaaatcaa
ggacttttggtgccaattatcaagaacgtggatcaaataggaatatttgagatatctaag
atgataatcaaattatctgaaaaagcaagattaggaaaattgtccttagaggatatgaga
ggaggaggatttacgatttcaaatcttggaagtacaggaaaaaatgttggattctttact
ccaattataaactcaccagaagtagcaattttaggaatttctcgatcttttatgaagcct
gtttggaatggttcgagctttctagccaaattaacagtaccgatatctttatcttttgat
catagagtgattaatggagcggatggagcaaaatttttagaccaggtgtcttttttaata
caagatcttagaaacttgctaatgtag

DBGET integrated database retrieval system