KEGG   Candidatus Riesia pediculicola: RIEPE_0181Help
Entry
RIEPE_0181        CDS       T01218                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00300  Lysine biosynthesis
rip01100  Metabolic pathways
rip01120  Microbial metabolism in diverse environments
rip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RIEPE_0181 (dapE)
Enzymes [BR:rip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RIEPE_0181 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADD79542
UniProt: D4G7Y9
Position
complement(179584..180714)
Genome map
AA seq 376 aa AA seqDB search
MIDQTIKILQKMIKIPSISPNDLGCQEILIGTLKKVGFLVERINFNNVKNFFASHGEKKG
KVLLFVGHTDVVCPGSLKDWRYYPFDPVIKDNSIYGRGTADMKGAIASMILSAKEFVTSF
PDHIGKLAFLITSDEEGSAKYGTKKVVEILKKRKEKIDYCIIGEPTSEFIVGDTIKNGRR
GSLNLNLFLYGPQGHVAYLDPIKNPVNLVVPLLKKLIFRSNMIDKFSKNVSSQIVKISSN
SYGNNITPSQVEIKMNFRFDKEINHDFVKQYISSEIEKHTSSYKLFWKLSAKPFEKKSKE
LIEIINKILIEKFSLFPKLSHSGGTSDGRFIIEICNQIVEIGLINQTIHQPNEMIEIQDL
IRLNTIYLEIMKKILL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcaaactataaagattcttcaaaaaatgattaaaataccatctatcagtcca
aatgatttaggctgtcaagagattttgattggaactctaaaaaaggttggttttttagtt
gaaagaataaattttaacaatgttaaaaatttttttgcttctcatggagagaagaaaggg
aaagttctactatttgttggtcatactgacgtagtatgtcctggttctcttaaagattgg
agatactatcctttcgatcctgtgatcaaagataattcaatttatggaagaggaacagca
gacatgaaaggagccatagcttccatgattttgtctgctaaagaattcgtaacttccttt
ccagatcatattggaaaattagcatttctaatcacttcagatgaagaaggatcagcaaaa
tatggaacaaaaaaagtggttgaaattttaaaaaaaagaaaagaaaaaatagattactgc
atcattggagaacctactagtgagtttatagtcggagataccataaaaaatggtagaaga
ggttctttaaatctgaatttatttctatatggtcctcaaggacatgtcgcatatcttgat
cctataaaaaatccagtcaatcttgtcgtcccacttttaaaaaaattgatttttagatcc
aacatgatagataaattttctaaaaatgtttcttctcaaattgtaaagatttcttccaat
tcttatggaaacaatattactccatctcaagtagaaataaaaatgaactttcgattcgat
aaagagattaatcatgatttcgtcaaacaatatatatcttctgaaattgaaaaacatact
tcttcctataaacttttttggaaactttctgcaaaacccttcgaaaagaaaagtaaagaa
ctgattgaaattattaataaaatattaatagaaaaatttagtttgtttccaaaattatct
cattctggaggaacttctgatggtcgttttattatcgaaatttgtaaccaaatagtagaa
ataggattgataaatcaaacaattcatcaaccgaatgagatgatagaaattcaggatttg
atcagattaaacacaatttatttagaaattatgaagaaaattcttttataa

DBGET integrated database retrieval system