KEGG   Candidatus Riesia pediculicola: RIEPE_0229Help
Entry
RIEPE_0229        CDS       T01218                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rip  Candidatus Riesia pediculicola
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIEPE_0229 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIEPE_0229 (sdhD)
   00650 Butanoate metabolism
    RIEPE_0229 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RIEPE_0229 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
228402..228734
Genome map
AA seq 110 aa AA seqDB search
MTNKKENLSGTKNWIILRITSIISLIYLFYILIFFSEREIDHTSLQEFFLKRPVKILTIF
AVFSTVVHFLIGTQNILTDYIKNKKLKILIYSTLYVFLAFHLFYLKKIIF
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtgactaataaaaaagagaatctttctggaacaaaaaattggattattttaaggattact
tcaattatatcactaatttatttgttctatattttaatttttttttcagaaagagaaata
gatcatacatctttgcaagagtttttcttaaagagacctgtgaaaatcttaacgatattc
gcagttttttcaacagtggttcatttccttattgggacacaaaatattttgacagattat
attaaaaacaaaaaattaaaaattttgatttattccactttatatgtttttttagcattt
catctattttatttgaaaaaaattatcttttag

DBGET integrated database retrieval system