KEGG   Candidatus Riesia pediculicola: RIEPE_0229Help
Entry
RIEPE_0229        CDS       T01218                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00020  Citrate cycle (TCA cycle)
rip00190  Oxidative phosphorylation
rip00650  Butanoate metabolism
rip01100  Metabolic pathways
rip01110  Biosynthesis of secondary metabolites
rip01120  Microbial metabolism in diverse environments
rip01130  Biosynthesis of antibiotics
rip01200  Carbon metabolism
Module
rip_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIEPE_0229 (sdhD)
   00650 Butanoate metabolism
    RIEPE_0229 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RIEPE_0229 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS TctB
Motif
Other DBs
NCBI-ProteinID: ADD79478
UniProt: D4G833
Position
228402..228734
Genome map
AA seq 110 aa AA seqDB search
MTNKKENLSGTKNWIILRITSIISLIYLFYILIFFSEREIDHTSLQEFFLKRPVKILTIF
AVFSTVVHFLIGTQNILTDYIKNKKLKILIYSTLYVFLAFHLFYLKKIIF
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtgactaataaaaaagagaatctttctggaacaaaaaattggattattttaaggattact
tcaattatatcactaatttatttgttctatattttaatttttttttcagaaagagaaata
gatcatacatctttgcaagagtttttcttaaagagacctgtgaaaatcttaacgatattc
gcagttttttcaacagtggttcatttccttattgggacacaaaatattttgacagattat
attaaaaacaaaaaattaaaaattttgatttattccactttatatgtttttttagcattt
catctattttatttgaaaaaaattatcttttag

DBGET integrated database retrieval system