KEGG   Candidatus Riesia pediculicola: RIEPE_0233Help
Entry
RIEPE_0233        CDS       T01218                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00020  Citrate cycle (TCA cycle)
rip00310  Lysine degradation
rip01100  Metabolic pathways
rip01110  Biosynthesis of secondary metabolites
rip01120  Microbial metabolism in diverse environments
rip01130  Biosynthesis of antibiotics
rip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIEPE_0233 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RIEPE_0233 (sucB)
Enzymes [BR:rip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RIEPE_0233 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADD79558
UniProt: D4G837
Position
234147..235343
Genome map
AA seq 398 aa AA seqDB search
MKKNCSKNPVLAPNLSESVSEANVLKWRKKVGDFVKEGELLVEIETDKIVLEISSPVSGT
LESVLKGVGSLVKSREVLGYVNNCGDRKYIEKLSSDYFQKKSNRNESFSSPSLRRKILKD
QNKLLTQKKNLKELDNFFKEEMNSVDKKKYPFGNMDLSLKKSMEKKNKSYKIIPMTNIRK
CISDRLLRSKNNSVTLTTFNEINMQSIMNIRRSYERSFEKMYGFKMGITSFFVKACANSL
KKYPEINASIDRENILYHNHIDINVAVSTKRGLITPILRKVEELHLVDIEKKIKEIIEKS
SKNYLDLQDLKSGSFTITNGGIFGSLMSTPIINPPQSAILGMHVVQDRVISENKEIKISP
MMYVTLSYDHRIIDGKEAIGFLLDVKESLENPILLLLS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaattgttcaaaaaatccagtattagcaccaaatctttctgaatccgtatct
gaggccaatgtattgaaatggagaaaaaaagtaggtgattttgttaaagaaggtgagtta
ttggtagaaattgaaactgataagattgttttagagatttcttctccagtttctggaact
ttagaatcagtattaaaaggtgttggatctttagtaaagtcaagagaagtcctaggatat
gttaataattgtggtgatcgaaagtatattgaaaaactttcttcagattattttcagaag
aaatcaaatcgaaatgaatctttctcttctccttctttacgcagaaaaatcttgaaggat
caaaataaacttttaacacaaaaaaagaatttaaaagagttagataatttttttaaagaa
gaaatgaattctgttgataaaaaaaagtatccttttgggaacatggatttatctctcaaa
aaatcaatggaaaagaaaaacaaatcttataagataataccgatgacaaacatcaggaaa
tgtatttctgatcgattattacgttcaaaaaataattccgttacactaacgacgtttaat
gagataaatatgcaatcgattatgaatataagaagatcttacgaaagaagtttcgaaaaa
atgtatggatttaagatgggaataacttcttttttcgtaaaggcttgtgcaaattctttg
aagaaatatccggaaataaacgcatcgattgatagggaaaatattttatatcataatcac
attgacattaatgtagctgtatctactaaaagaggattgattaccccgattctaagaaaa
gtagaagaacttcatttggtagatatagagaaaaaaataaaagaaattattgaaaaaagt
tcgaaaaattatctggatcttcaagatttaaaaagtggaagtttcacaattactaatgga
ggaatatttggatcattgatgtcaactccaattattaatcctcctcagagcgcaatactt
ggaatgcatgtagttcaagaccgggtaatatctgaaaataaagaaataaaaatttctcca
atgatgtatgtaactttatcttacgatcacagaataatcgacggaaaggaagcaatcggt
tttttattggatgtaaaggaatctttagaaaatccgatactacttctattgagttaa

DBGET integrated database retrieval system