KEGG   Candidatus Riesia pediculicola: RIEPE_0234Help
Entry
RIEPE_0234        CDS       T01218                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIEPE_0234
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIEPE_0234
   00640 Propanoate metabolism
    RIEPE_0234
   00660 C5-Branched dibasic acid metabolism
    RIEPE_0234
Enzymes [BR:rip01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RIEPE_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
235382..236572
Genome map
AA seq 396 aa AA seqDB search
MYLYEYQVKRMLFLSGFLVPKGFFCQTIEEVRNAIFQLNQKIFVLKCQIQSGGRKKSGAI
EIVSNIKEAELFFFKWMNKKLITNQTNSGGQLVIGILVEEHVSIKKETYASISLDKNDKQ
IMLIFSSSGGTEVEKYHRNCKKLFRKIEIDPIKKLTLNILEKHVDNLGYQKKEGKFFSKF
LIKLLNMFFYLDLLFVEINPIAIDKKGRFFCLDGKSNMDCNAFFRKKELKKNILKFDSKI
DNEKFKLYEPSNYVLLKGNIGCIANGAGLAMATMDLIKIYGGNPANFLDIGGNTDLSGMK
SYIHKVLVQKNVNVILINIFGGIVRCEIVAEALIQSLKDIQNECFPKILIRLSGNGYQSG
INYIEKSGFNNIFVMDNLEKMVKRSVHLAKNVYFNK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtatctatacgaatatcaagttaaaagaatgctctttctttctggttttttagttcca
aaaggtttcttttgtcaaacaatcgaagaagttagaaacgcaattttccaactgaatcaa
aaaatttttgttctaaaatgtcaaatacaatctggaggaagaaaaaagtcaggagcaatt
gagatagtttctaacataaaagaagccgaattatttttttttaagtggatgaataagaaa
ctaattacaaatcaaaccaactcaggtggtcaattagtaatcggaatattagtagaagag
catgtttcaattaaaaaagaaacttatgcaagtatatcattggataagaatgataaacaa
attatgttgatcttctcttcttctggtggaacagaagtggagaaatatcatagaaattgt
aaaaagttatttcgaaagattgagatagatcctatcaaaaaattgacgttgaatatacta
gaaaaacatgtagataatttaggctatcaaaaaaaagaagggaaatttttttcaaaattt
cttataaaattattaaatatgtttttctatttagatcttctatttgtagagatcaatccg
atagctattgataaaaaggggaggtttttctgtttagatggaaaatcaaacatggattgt
aatgctttctttcgaaaaaaagaactaaaaaagaatatattaaaatttgattctaaaata
gataatgaaaaatttaaattatatgaaccttcaaattatgttttattgaaaggaaatata
ggatgcatcgctaatggagcaggattggctatggcgacgatggatctaataaaaatttat
ggaggaaatccagctaattttttagatataggaggaaacacagacttatctggaatgaag
tcttatattcataaggtactagttcaaaaaaatgtcaatgtaatcttaattaatatattt
ggaggaatcgtgagatgtgagatcgtcgcagaagctttaatacaatctttaaaggacatc
caaaacgaatgttttccaaaaatattgattagattatctggaaacggatatcaatctgga
ataaattatatagaaaaaagcggttttaataatatcttcgttatggataatttagaaaag
atggttaaaagatcggttcatttagcaaaaaatgtctattttaataaataa

DBGET integrated database retrieval system