KEGG   Candidatus Riesia pediculicola: RIEPE_0234Help
Entry
RIEPE_0234        CDS       T01218                                 

Definition
succinyl-CoA synthetase beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIEPE_0234
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIEPE_0234
   00640 Propanoate metabolism
    RIEPE_0234
   00660 C5-Branched dibasic acid metabolism
    RIEPE_0234
Enzymes [BR:rip01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RIEPE_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
235382..236572
Genome map
AA seq 396 aa AA seqDB search
MYLYEYQVKRMLFLSGFLVPKGFFCQTIEEVRNAIFQLNQKIFVLKCQIQSGGRKKSGAI
EIVSNIKEAELFFFKWMNKKLITNQTNSGGQLVIGILVEEHVSIKKETYASISLDKNDKQ
IMLIFSSSGGTEVEKYHRNCKKLFRKIEIDPIKKLTLNILEKHVDNLGYQKKEGKFFSKF
LIKLLNMFFYLDLLFVEINPIAIDKKGRFFCLDGKSNMDCNAFFRKKELKKNILKFDSKI
DNEKFKLYEPSNYVLLKGNIGCIANGAGLAMATMDLIKIYGGNPANFLDIGGNTDLSGMK
SYIHKVLVQKNVNVILINIFGGIVRCEIVAEALIQSLKDIQNECFPKILIRLSGNGYQSG
INYIEKSGFNNIFVMDNLEKMVKRSVHLAKNVYFNK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtatctatacgaatatcaagttaaaagaatgctctttctttctggttttttagttcca
aaaggtttcttttgtcaaacaatcgaagaagttagaaacgcaattttccaactgaatcaa
aaaatttttgttctaaaatgtcaaatacaatctggaggaagaaaaaagtcaggagcaatt
gagatagtttctaacataaaagaagccgaattatttttttttaagtggatgaataagaaa
ctaattacaaatcaaaccaactcaggtggtcaattagtaatcggaatattagtagaagag
catgtttcaattaaaaaagaaacttatgcaagtatatcattggataagaatgataaacaa
attatgttgatcttctcttcttctggtggaacagaagtggagaaatatcatagaaattgt
aaaaagttatttcgaaagattgagatagatcctatcaaaaaattgacgttgaatatacta
gaaaaacatgtagataatttaggctatcaaaaaaaagaagggaaatttttttcaaaattt
cttataaaattattaaatatgtttttctatttagatcttctatttgtagagatcaatccg
atagctattgataaaaaggggaggtttttctgtttagatggaaaatcaaacatggattgt
aatgctttctttcgaaaaaaagaactaaaaaagaatatattaaaatttgattctaaaata
gataatgaaaaatttaaattatatgaaccttcaaattatgttttattgaaaggaaatata
ggatgcatcgctaatggagcaggattggctatggcgacgatggatctaataaaaatttat
ggaggaaatccagctaattttttagatataggaggaaacacagacttatctggaatgaag
tcttatattcataaggtactagttcaaaaaaatgtcaatgtaatcttaattaatatattt
ggaggaatcgtgagatgtgagatcgtcgcagaagctttaatacaatctttaaaggacatc
caaaacgaatgttttccaaaaatattgattagattatctggaaacggatatcaatctgga
ataaattatatagaaaaaagcggttttaataatatcttcgttatggataatttagaaaag
atggttaaaagatcggttcatttagcaaaaaatgtctattttaataaataa

DBGET integrated database retrieval system