KEGG   Candidatus Riesia pediculicola: RIEPE_0237Help
Entry
RIEPE_0237        CDS       T01218                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rip  Candidatus Riesia pediculicola
Pathway
rip00010  Glycolysis / Gluconeogenesis
rip00260  Glycine, serine and threonine metabolism
rip00680  Methane metabolism
rip01100  Metabolic pathways
rip01110  Biosynthesis of secondary metabolites
rip01120  Microbial metabolism in diverse environments
rip01130  Biosynthesis of antibiotics
rip01200  Carbon metabolism
rip01230  Biosynthesis of amino acids
Module
rip_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIEPE_0237
  Energy metabolism
   00680 Methane metabolism
    RIEPE_0237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RIEPE_0237
Enzymes [BR:rip01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RIEPE_0237
Membrane trafficking [BR:rip04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RIEPE_0237
Exosome [BR:rip04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RIEPE_0237
  Exosomal proteins of melanoma cells
   RIEPE_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADD79583
UniProt: D4G840
Position
complement(237508..238191)
Genome map
AA seq 227 aa AA seqDB search
MFVRLVIIRHGTSIWNQLNKFTGWTDVPLSKEGYIEAKKAGKILKKNRITFDVAYTSFLK
RAIHTLWEVLKEIDKSWIPVYKTWNLNERHYGALQGLNKEEVSKEYGKDQVELWRRSFKI
KPPSLKENSVFMKDVRYNTIIKKNFPDSESLEDTLKRVVPLWKEEIKPKIKRKNKVLIVA
HGNSLRALAKHLENISEESISKLNIPTAKPIVYEFDRNIDVINRYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttcgattggttattatacgacatggaacaagtatatggaatcagttaaataaa
tttactggatggacagatgttcctttgtcaaaagagggttacatagaagcaaaaaaagca
ggaaagatcttaaaaaaaaataggataacatttgatgttgcttatacttcctttttaaaa
cgagcaatccatactttatgggaagttttaaaagaaattgataaaagttggattccggtt
tataaaacctggaatcttaatgaaagacattacggtgcgttacaaggtttaaataaagaa
gaagttagtaaagagtacggaaaagatcaagtcgaactttggagaagaagtttcaaaatc
aaaccaccttctcttaaagagaattctgtttttatgaaagatgttcgctacaatacaata
attaaaaaaaattttccggattcagagagcttagaagatactcttaaaagagtagttcca
ctatggaaagaagaaattaaacctaaaataaaaagaaaaaataaagttttaattgtcgct
catggaaattctcttagagctttggcaaaacatttagaaaacataagtgaagaatctatt
tcaaagctaaatattcctaccgcaaaacctattgtatatgaatttgatagaaatatagat
gtgatcaatagatattatctctga

DBGET integrated database retrieval system