KEGG   Candidatus Riesia pediculicola: RIEPE_0382Help
Entry
RIEPE_0382        CDS       T01218                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RIEPE_0382 (tpiA)
   01230 Biosynthesis of amino acids
    RIEPE_0382 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIEPE_0382 (tpiA)
   00051 Fructose and mannose metabolism
    RIEPE_0382 (tpiA)
   00562 Inositol phosphate metabolism
    RIEPE_0382 (tpiA)
Enzymes [BR:rip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RIEPE_0382 (tpiA)
Exosome [BR:rip04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RIEPE_0382 (tpiA)
  Exosomal proteins of bladder cancer cells
   RIEPE_0382 (tpiA)
  Exosomal proteins of melanoma cells
   RIEPE_0382 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(376216..376998)
Genome map
AA seq 260 aa AA seqDB search
MKRKIIVGNWKLNGSFSMIEKFFKNLKTETLKSSKYDLILAPPFPYLIKMKEIMKKYSNI
FLGAQNVDIHSDGPYTGEVSSSMLRDVGVKYTIIGHSERRKYHQENDRMIKRKILSLQKE
NIIPISCIGESLEEKELKKTESVLIDQVKPIIDVMKKNCFEEIVIAYEPIWSIGTGKVAD
SNSIQRTSNFIKKYVHDRLNIKEEKLSIIYGGSVDSMNFQKFIREKDIDGLLIGKSSIDC
RSISEILSFSGDFLNVSNTS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaagattattgtgggaaattggaaattaaatggaagtttttctatgattgaa
aaattttttaaaaatttaaagacagaaactctgaaatccagtaagtatgatttgatactc
gctcctccttttccgtatctaatcaagatgaaagaaatcatgaaaaaatattcaaatata
tttcttggagcgcaaaacgttgatattcattcagatggaccatacactggagaagtttct
tcttctatgttaagagatgtaggagtaaagtatacaattataggacattctgaaagaaga
aaatatcatcaggagaatgatcgaatgatcaaaagaaaaattctttcattgcaaaaagaa
aatataataccgatatcatgcataggagagtctctagaagagaaagaattaaagaaaact
gaatcagttttgatcgatcaagttaaaccgatcattgatgttatgaaaaaaaattgtttt
gaagaaatcgtgattgcttacgaaccaatttggtctataggaacaggaaaagtggcggat
tctaactcaattcaaagaacttcgaattttatcaagaagtacgtacatgatcgtctaaac
attaaagaagagaagttgtccataatttatggaggatcggtagatagcatgaactttcaa
aagtttataagagaaaaagatattgacggacttcttataggaaaatcttctatcgattgt
cgatccatttctgaaatcctatcattttctggagattttttaaatgtatcaaatacaagt
taa

DBGET integrated database retrieval system