KEGG   Candidatus Riesia pediculicola: RIEPE_0385Help
Entry
RIEPE_0385        CDS       T01218                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RIEPE_0385
Enzymes [BR:rip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RIEPE_0385
Exosome [BR:rip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RIEPE_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(378004..379551)
Genome map
AA seq 515 aa AA seqDB search
MKKVKKYILALDQGTTSSKSAIFDHSVNLLSFSKRSISQIYPEKGWIENDPEEIWNTQYE
TILEVVQESRINFDQIVGIGIANQRETTIIWEKNTGKPIYNAISWLCRRTEKFCNQLEEN
KKLSTYIRENTGLKIDPYFSGTKLRWILDRVEGAKERAEMGELLFGTVDSWLIWKMTKGK
LHMTDYTNASRTMLFNIRRLDWDQKILKALEIPKIMLPIVCSSSKIFAKVVLFPHQKKRI
PISSVMGDQQSSLYGNLCFSFGSIKSTYGTGCFSLMSIEKKFFVPKNELLTTISCGPKGE
SYYALEGTVPFGGASVQWLKDRIGIICSTEDASIKLKQVNSSEGIYFVPDRFLSLSHSKI
DSWNPFLKGSIVGITMHSNKLHIIRAILESISFQNMDVLEDMKKEIEKNKLYIKELKVDG
NASSNDLLIQFQSDILGISVKRSKFKENSILGTALLSGITIGFWRDIQEIRKKVSKYETF
LPSISSKDGYLKYSRWKKVSSILFDLKKIILEGKS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttaaaaaatacattttagcattagatcaaggtaccacatcttcaaagagt
gccatatttgaccattcagtcaacttattatctttttcaaagcgttcgatatctcaaatt
tacccagagaaaggatggatagaaaatgatcctgaagaaatatggaatacacaatatgaa
actattcttgaagtagttcaggaatctcgaataaattttgatcagatagtagggatagga
attgctaatcaaagagaaacaactattatttgggaaaaaaatactggaaaacctatctat
aacgctatatcttggttatgtaggagaacagaaaagttttgtaatcaattagaagaaaat
aaaaaattgagcacttatattcgagagaatacaggattaaagatagatccatatttttct
ggaacgaagttaagatggatattggatagagttgaaggggcgaaagaaagggcggaaatg
ggagaattattgtttggaacagtagattcttggttgatctggaagatgaccaaaggaaaa
cttcatatgactgattatactaacgcttctagaacgatgttatttaacattcgtagatta
gattgggatcaaaagatactcaaagctttagaaatcccaaaaatcatgcttcctatcgta
tgctcttcctctaaaatatttgcaaaagttgtactatttcctcatcagaaaaagagaata
ccaatatctagtgtcatgggagatcagcaatcttctttatacggaaatctatgtttttct
ttcggatcaataaaaagtacatatggaaccggatgtttttctttgatgagcattgaaaag
aaattttttgttcctaaaaatgagctgttaaccaccatttcttgtgggcctaagggagaa
agttactatgctttagaaggaactgtaccattcggaggagcttctgttcagtggttaaaa
gatcgcattggaatcatttgttccacagaagatgcttctatcaaattaaaacaagtaaat
agtagcgaaggaatatattttgttcctgacagattcttatctttatctcattcaaaaatc
gacagttggaacccttttttaaagggatcgatagttggtattacaatgcattctaacaag
cttcatatcattcgagcaattttggaatcaatctcatttcaaaatatggatgttttggaa
gatatgaaaaaagaaatagagaaaaataaattatacattaaagaacttaaagtagacgga
aatgcatcttccaacgatcttttaatacaatttcagtcagatatattaggaatatctgtc
aaacgatcaaaatttaaggaaaattccattttaggaactgcattattatcgggaattaca
ataggattttggagagatatacaagaaatccgtaaaaaagtcagcaaatatgaaactttt
ttaccaagtataagttcaaaagatggatatctcaaatactcaagatggaaaaaagtttct
tctattctattcgatttaaaaaaaatcatacttgaaggtaaaagttaa

DBGET integrated database retrieval system