KEGG   Candidatus Riesia pediculicola: RIEPE_0486Help
Entry
RIEPE_0486        CDS       T01218                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rip00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rip00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(461980..463494)
Genome map
AA seq 504 aa AA seqDB search
MKTYRNLSDLLHQSKKLVANVKFKEIKLDSRKIEKGDIFLAIVGSQKDGRKYINHAISRG
ASAIIAESNSLTKEDEFIKFLNQIPIVFVKNIRKKIVFFSKKLYGSLNKKMKLIGVTGTN
GKTTVSHIVAQLAKLIGQKSAVMGTIGNGLIGEKIYPSELTTLSCFEICSTLKMFLEKSV
KIVAMEVSSHGLDQGRTCSLSFSSAIFTNITRDHLDYHNNIEHYELSKKKLFYEHDCKNR
VFFIDDPVGSKWIKDFPNSCAVSINHKNKLNLLNRPILYATKIEYLYNQTIIRFNSDWGN
GEIRTSFLGEFNVANFMLAIASLLMIGYPIHLLIKNSKRVSPVIGRMQLVSHYNPRVIID
YAHNSDSLKQCLISIRKHFGGKIWCVFGCGGSRDKGKRAIMGRIAEKYSDFVIITDDNPR
FEDPKKIFKEILRGCTHLESIRYFPERKYAIRYSISRAKPNDTVLIAGKGHEEKQIVGDR
KILCSDYQIVVSYLKNYSLCFKQI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagacataccgaaatttatcggatcttttacatcaatcaaaaaaacttgttgcaaat
gtaaagtttaaagaaatcaagttagatagcagaaaaattgaaaaaggagatatattctta
gctattgttggatctcaaaaagatggaaggaaatatattaatcatgccatatcgagaggt
gcttctgctataattgctgaatccaacagtttaactaaagaagatgaattcataaaattc
ttgaatcaaataccaatcgtatttgtcaaaaatataagaaagaaaatagtttttttttca
aaaaagttatatggatctttaaacaaaaaaatgaagttgattggagtgacaggaaccaat
ggtaaaaccactgtttctcatatcgttgcgcaattagcaaaattaattggacaaaaaagt
gcagttatgggaactataggaaatggattaattggagaaaaaatttatccaagtgaacta
acaactttatcttgttttgaaatttgttcaacattaaaaatgtttcttgaaaaaagcgtg
aaaatagtagctatggaagtttcttcacatggattggatcaaggaaggacttgtagtcta
tctttttcttccgcaatttttacaaatatcacaagagatcatttagactatcataataat
attgagcattacgaattatcgaagaaaaaactattttacgaacatgattgcaaaaataga
gtatttttcatagatgatccagttggatctaaatggattaaagatttcccaaattcctgt
gcagtatccattaatcataaaaataaattaaatttattaaatcgacctatattatatgca
acaaaaattgaatacttatacaatcaaacaataattcgattcaattctgactggggtaat
ggggaaataagaacatcatttttaggagaatttaatgtagctaatttcatgttagctata
gcatcacttttgatgattggatacccaattcatcttttgattaaaaattcgaaaagagta
tctcctgttatcggacgtatgcaattagtttcacattataatccaagagttattatagat
tatgctcataattcagattctttaaagcaatgtttaatttcaatcaggaaacattttgga
ggaaaaatttggtgcgtattcggttgcggaggaagtcgagataaagggaagagagcaatt
atgggaagaatagcagaaaaatattctgattttgtcatcataactgatgataatcccaga
tttgaagatcctaaaaaaattttcaaagaaattttacgaggatgtactcatttagaatct
atacgatattttccggaacgcaaatatgctattagatattctatttcaagagcaaaaccg
aatgatacagttctaattgcaggaaaaggtcatgaagagaaacaaattgtaggagatcga
aaaatactttgttctgattatcagattgtagtcagttacctaaaaaactattctttatgt
ttcaaacagatttaa

DBGET integrated database retrieval system