KEGG   Candidatus Riesia pediculicola: RIEPE_0570Help
Entry
RIEPE_0570        CDS       T01218                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RIEPE_0570
Enzymes [BR:rip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RIEPE_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546297..546872
Genome map
AA seq 191 aa AA seqDB search
MSFSNEKSSMIQKKLQMNGVNVQSEINIDQSLKHLSQEYAKMFSKSGYNHFPKIDLMKND
TRSDQMIMINNIQFISFCEHHLLVIDGFSTVAYVPKKYIVGFSKISQIVHFFSKRPQLQE
RLTRQILISLKTILDIEDVAVFVRAVHYCMKLKTQDGSSDVITTELSGSFLSNHSLKNNF
FRSCYSFNKGG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcaaatgaaaaatctagtatgattcagaaaaaacttcagatgaatggtgtg
aatgtacaatctgaaattaatatcgatcaatctttaaaacatctttctcaagaatatgct
aaaatgttttccaaatcaggttataatcattttccaaaaatcgatctcatgaaaaatgat
acacgatctgatcaaatgattatgatcaataatattcagttcatcagtttttgcgaacat
catttattagtgatagatggattttccacagtggcatatgttcctaaaaagtacatcgtt
ggattttctaaaatttcccaaatagttcatttcttttctaaaagacctcaacttcaggag
agacttaccagacagatattaatttctttgaagactatattggatattgaggatgttgcc
gtatttgtaagggcggttcactactgtatgaagttgaaaacacaagatggatcaagtgat
gtcattacgactgaattaagtggatcatttttatcaaatcattcgcttaaaaacaatttt
tttaggtcatgttatagttttaataaaggtggataa

DBGET integrated database retrieval system