KEGG   Candidatus Riesia pediculicola: RIEPE_0570Help
Entry
RIEPE_0570        CDS       T01218                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rip  Candidatus Riesia pediculicola
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rip00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546297..546872
Genome map
AA seq 191 aa AA seqDB search
MSFSNEKSSMIQKKLQMNGVNVQSEINIDQSLKHLSQEYAKMFSKSGYNHFPKIDLMKND
TRSDQMIMINNIQFISFCEHHLLVIDGFSTVAYVPKKYIVGFSKISQIVHFFSKRPQLQE
RLTRQILISLKTILDIEDVAVFVRAVHYCMKLKTQDGSSDVITTELSGSFLSNHSLKNNF
FRSCYSFNKGG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcaaatgaaaaatctagtatgattcagaaaaaacttcagatgaatggtgtg
aatgtacaatctgaaattaatatcgatcaatctttaaaacatctttctcaagaatatgct
aaaatgttttccaaatcaggttataatcattttccaaaaatcgatctcatgaaaaatgat
acacgatctgatcaaatgattatgatcaataatattcagttcatcagtttttgcgaacat
catttattagtgatagatggattttccacagtggcatatgttcctaaaaagtacatcgtt
ggattttctaaaatttcccaaatagttcatttcttttctaaaagacctcaacttcaggag
agacttaccagacagatattaatttctttgaagactatattggatattgaggatgttgcc
gtatttgtaagggcggttcactactgtatgaagttgaaaacacaagatggatcaagtgat
gtcattacgactgaattaagtggatcatttttatcaaatcattcgcttaaaaacaatttt
tttaggtcatgttatagttttaataaaggtggataa

DBGET integrated database retrieval system