KEGG   Rhizobium sp. IRBG74: BN877_I0131Help
Entry
BN877_I0131       CDS       T02867                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rir  Rhizobium sp. IRBG74
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rir00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136856..138172
Genome map
AA seq 438 aa AA seqDB search
MSLIPQETIRRKRDGLALSPQEIAAFIEALSKDGISEGQAAAFAMAVFFRGMNRDEMVAL
TLAMRDSGDVLSWSDIGRPVADKHSTGGVGDNVSLMLAPIVAACGLAVPMISGRGLGHTG
GTLDKLEAIPGYNVMPDEVLFRRAVKTVGCAIIGQTGDLAPADRRLYAIRDVTATVDSIP
LITASILSKKLAAGLQTLVLDVKVGNGAFMQSIDDARTLARALVDVAVGAGLPTTALITD
MNQPLGDAAGNAVEIVNCLDFLAGRKAGSRLENVVLSFAAEMLVQAQKTATLEEGAALAS
AALSSGRAMEIFARMISALGGPTDFVENPSLYLPSAPVTLPVQAASSGWLTSCATRELGI
AVVGLGGGRRKPSDRINPAVGISNILPLGMKVEKGEPIAIVHAASGEDAAYAIKAITACY
GISDDAPEVAAPVLERIT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttgagcttgatcccgcaggaaaccatccgccgcaaacgcgatggcctggcgctctcgccg
caggagatcgctgcattcatcgaagcgctgtcgaaagacggcatctcggaagggcaggcg
gcggcttttgccatggcggtgtttttccgtggcatgaaccgggatgagatggtggcattg
acacttgccatgcgtgacagcggtgatgtcctgtcctggagcgatatcggcaggccggtt
gccgacaagcactcgaccggtggcgttggagacaatgtctctctgatgctcgccccgatc
gtagccgcctgtggtctcgctgtgccgatgatttccggcaggggccttgggcataccggc
ggcacgctggacaagctggaagcgattcccggttacaatgtcatgccggacgaggttctg
tttcgccgggcggtgaagacggtcggctgtgccatcatcggtcagacgggtgacctcgcc
cccgctgacagacgcctctatgccattcgcgatgtgaccgcgacggtcgattccataccg
ctgattacggcttccatcctgtcgaagaagctggcggccgggctgcagacgcttgtgctt
gatgtcaaggtcggcaacggcgcctttatgcaaagcattgacgatgcacggacgctcgcc
cgcgcgctggtcgatgtggctgttggcgcaggtttgccgacaacggcgctgataacagat
atgaaccagccgcttggcgatgccgccggcaatgccgttgaaatcgtcaattgtctcgat
tttctggctggtcgcaaggctggcagccgtctggaaaacgtggttctgtctttcgcggcg
gaaatgctcgtgcaggctcaaaaaacggccacactggaagaaggcgcagcactggcgtcg
gccgccctctcctccggccgggcaatggaaattttcgcgcgaatgatttcggcattgggc
gggccaacggatttcgttgaaaatccttccctttatctgccgtccgcgccagtcactctt
ccggtccaggccgcgagcagcggctggctgacatcctgcgcaacgcgcgaactcggcatc
gccgtcgtcggacttggcggcggcagacgaaaaccctcggacaggatcaatcccgccgtt
ggtatttcgaatatcctgccgcttgggatgaaggtggaaaagggagaaccgattgccatt
gtccatgcagcgtccggagaagacgcagcctacgccattaaagcgataacggcctgctat
ggaatcagcgacgacgcgccggaagtcgctgcacccgttctcgagcggatcacctga

DBGET integrated database retrieval system