KEGG   Rhizobium sp. IRBG74: BN877_I0365Help
Entry
BN877_I0365       CDS       T02867                                 

Definition
Sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rir  Rhizobium sp. IRBG74
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rir00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN877_I0365
Enzymes [BR:rir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN877_I0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(356021..356920)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLVATAKRLPKPGETVTGETFSTAAGGKGANQALAARRAGATVKMAGAAG
DDTFAAPALTLLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSASDAA
KTISEMAPSDILMLQFEIPAPAIEAALTAAKAKRVTTVINTAPLTADGPRLAGLADIVIA
NETEFELLIGKNGLSSDERENELKALHERTGQTLIVTLGADGVIAIRNGKLYRASGLKIE
PVDTVGAGDTFCGYLAASLDQGMDFERALKRAAVAGSLACTRAGAQPSIPQAAEVDAAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgattactgttttcggctccatcaacatggacctcgtcgcgaccgccaaacgtctgccc
aagcccggtgaaaccgtgaccggcgagacattctccacggccgccggcggcaagggcgcc
aatcaggcgctggccgcacggcgtgcgggcgccacggtcaagatggcgggcgctgcgggt
gatgacacctttgccgcaccagcgctgaccttgctacgcgacgcgggaaccgatctgtca
ttggtcaaaaccgcgcccggcccgactggaacggcggttatcctgatcggtgaaggcgga
gagaacatgatctcggtcattcccgctgcgaatggtgaggtctcggcatccgacgcggca
aagaccatatccgaaatggctccaagcgatattctcatgctgcagttcgagataccggca
cccgccatcgaagctgcactgacggccgcaaaggcgaaacgcgtcaccaccgtcatcaac
acagcaccgctgaccgcggacggaccgcgtctcgccggccttgccgatatcgtcatcgcc
aatgaaaccgagttcgagctgctgatcggcaagaatggcctctccagcgacgagcgggaa
aacgaactcaaggcccttcacgagaggaccggccagactttgatcgtcacgcttggtgcg
gatggcgtgatcgccattcgtaatggcaagctctacagggcttccggcctgaagatcgag
ccggtcgatacggttggtgcgggcgataccttctgcggatatctcgccgcgagcctcgat
cagggaatggatttcgaaagggctctgaagcgggccgcagtcgcaggctcactcgcctgc
acgcgtgccggcgcgcagccttccattccgcaggcagcggaagttgacgcggccctttaa

DBGET integrated database retrieval system