KEGG   Rhizobium sp. IRBG74: BN877_II0985Help
Entry
BN877_II0985      CDS       T02867                                 

Gene name
amyA
Definition
cytoplasmic alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
rir  Rhizobium sp. IRBG74
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN877_II0985 (amyA)
Enzymes [BR:rir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BN877_II0985 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1010143..1011630)
Genome map
AA seq 495 aa AA seqDB search
MAGRTLLQFFHWYYPDGGKLWSEVAEKAESLAKMGITDVWLPPAYKGAAGGYSVGYDTYD
LFDLGEFDQKGTVATKYGDRGALEHAGKTLKENGIRVIHDVVLNHKMGADEKEKVRVRRV
NPDDRTDIDDEDFSALAYTRFTFPGRGGVHSKFIWDQKCFSGVDHIEEPTEDGIFRLVNE
YGDGEWNEEVDQENGNFDYLMGADVEFRNRAVYEELKYWGRWLSEQVQVDGFRLDAAKHI
PAWFFRDWVGHMRETIDPDLFVVAEYWHPDLEALKSYLELVDKQLMLFDVALHHSFHDAS
KQGGDFDMRSIFDGALVAAVPDHAVTLVDNHDTQPLQSLEAPVEPWFKPLAYAIILLREN
GVPCVFYPDLFGTSYTDTGNDGNEYKIDMPAIECLPKLIEARSRFANGVQTDIFDDPNCI
AFVRHGTADAPGCVVVMSNGEPAEKHVDLGPDHAGAVWRDFLGHRQEEITLDESGKGAFP
TNGGSVSVWVPAESG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccggacgcaccttgcttcaattcttccattggtattatccggacggagggaaatta
tggagcgaggtggccgagaaggccgaaagccttgccaaaatgggcattaccgacgtctgg
ctgccgcccgcctacaagggcgccgccggcggttattcggttggatatgacacctacgat
ctcttcgacctcggcgaatttgaccagaagggcaccgtcgccaccaaatacggtgatcgt
ggcgccctcgagcatgcgggcaagacgctgaaagagaatggcatccgtgtcattcacgac
gtcgttctcaatcacaagatgggtgccgacgagaaggaaaaggtacgggttcgccgcgtc
aatcccgacgatcgcacggatatcgacgacgaggatttttccgcactcgcttacacacgt
ttcacctttcctggccgaggcggcgtgcattccaaattcatctgggaccagaaatgtttc
agcggcgtcgatcacatcgaagagccgaccgaagacggcattttccggctcgtcaacgaa
tatggcgacggtgagtggaacgaggaagtcgatcaggaaaacggcaatttcgactatctg
atgggtgcggacgtcgagtttcgcaatcgggccgtctatgaagagctcaaatattggggc
cgctggctttccgagcaggtccaggtggacggcttccggctggatgccgcaaaacatatt
ccggcatggttcttccgcgactgggtcggccatatgcgcgagactattgaccccgatctt
ttcgtcgtagcggaatattggcaccccgatcttgaggccttgaagagctatctcgaactc
gtcgacaagcaactgatgcttttcgatgtcgcccttcaccacagcttccacgacgcgtcg
aaacaggggggtgattttgacatgcgcagcattttcgatggtgcgcttgttgccgccgtt
cccgatcacgccgtcacgcttgtcgataaccacgacacccagccattgcaatcgctggag
gccccggtggagccctggttcaagcccctagcctatgcgatcatattgctgcgtgaaaac
ggcgtgccttgcgttttttatcccgatctgttcggcacgagctataccgacacgggtaat
gacggcaatgagtacaaaatcgatatgccggccatcgaatgcctgccgaagctcatagag
gcgcgcagccgtttcgccaatggcgtacagacggacattttcgatgacccgaactgcatc
gccttcgttcgccatggcaccgccgatgcgcccggttgtgtcgtggtgatgtcgaatggc
gaaccggcggaaaagcatgtcgatctcggtccggatcatgcaggggcggtctggcgcgac
ttcctcgggcaccgtcaagaggagatcaccctcgatgagagcggcaagggcgccttcccc
accaatggcggcagtgtcagtgtttgggtgccagccgaatccgggtga

DBGET integrated database retrieval system