KEGG   Rhizobium sp. IRBG74: BN877_II1207Help
Entry
BN877_II1207      CDS       T02867                                 

Gene name
glgB1
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rir  Rhizobium sp. IRBG74
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rir00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN877_II1207 (glgB1)
Enzymes [BR:rir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BN877_II1207 (glgB1)
Exosome [BR:rir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN877_II1207 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1244599..1246806)
Genome map
AA seq 735 aa AA seqDB search
MKKPLNSADEKKTGDITKAEIEAIKSGLHSNPFALLGVHETPEGFSARCFIPGAEEVSVL
TLDGNFVGELKQLDPDGFFEGPIDISKRQPVRYRACRDDAEWAVTDPYSFGPVLGPMDDY
FVREGSHLRLFDKMGAHPLKLEGVEGFHFAVWAPNARRVSVVGDFNNWDGRRHVMRFRKD
TGIWEIFAPDVYAGCAYKFEILGANGELLPLKADPYARRAEFRPKNASVTTPELTQKWED
QAHREHWAQVDQRRQPISIYEVHAGSWQRREDGTFLSWDELAAQLIPYCTDMGFTHIEFL
PITEHPYDPSWGYQTTGLYAPSARFGDPEGFARFVNGAHKVGIGVLLDWVPAHFPTDEHG
LRWFDGTALYEHADPRQGFHPDWNTAIYNFGRVEVMSYLINNALYWAEKFHLDGLRVDAV
ASMLYLDYSRKEGEWIPNEYGGRENLESVRFLQKMNSLVYGTHPGVMTIAEESTSWPKVS
QPVHEGGLGFGFKWNMGFMHDTLSYFSREPVHRKFHHQELTFGLLYAFTENFVLPLSHDE
VVHGKGSLIAKMSGDDWQKFANLRSYYGFMWGYPGKKLLFMGQEFAQWSEWSEKGALDWN
LRQYPMHEGMRRLVRDLNLTYRSKAALHARDCEPDGFRWLVVDDHENSVFAWLRTAPGEK
PVAVICNLTPVYRENYYVPLPQAGRWREILNTDAEIYGGSGKGNGGRVQAVDAGGDIGAM
LVLPPLATIMLEPEN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccgctcaattcggccgacgagaaaaagactggcgacatcacgaaggctgaa
atcgaggcgatcaagagcggtttgcattccaatccctttgcccttctcggcgttcacgaa
acgccggaagggttttctgcccgctgtttcattccgggtgccgaggaggtttccgtcctg
acgctggacggaaatttcgtgggagaattgaagcagctggacccggatggcttttttgaa
ggcccgatcgatatttcgaaacgccagccggtgcgttaccgcgcctgccgcgacgatgcc
gaatgggctgtgacagacccctacagcttcggcccggttctcggccccatggatgattat
ttcgtccgggaaggatcgcatctgcggctgttcgacaagatgggcgcacacccgctgaag
ctcgaaggcgttgaaggttttcacttcgccgtctgggcgccgaatgcgcggcgcgtttcc
gtcgtcggcgatttcaacaattgggacggccgccggcatgtgatgcgtttccgcaaggat
acgggcatctgggaaatcttcgcgcccgatgtctatgccggttgcgcctacaagttcgag
attctcggtgcaaacggcgagctgctgccgctgaaggccgacccctatgcccgccgcgcc
gagtttcggccgaagaacgcttccgtcactacgcccgaactgacgcaaaaatgggaagat
caggcccatagggagcattgggcgcaggtggaccagcgccgccagccgattagcatctat
gaggtgcatgccggctcctggcagcgccgtgaggacggcaccttcctaagctgggacgag
ctcgccgcccagctcattccctattgtacggatatgggcttcacccatatcgagttcctg
ccgattacggaacatccctatgacccttcctggggttaccagacgacgggtctctacgcc
ccaagcgcacgttttggcgatcccgaagggtttgcccgcttcgtcaatggcgctcacaag
gttggcatcggcgttttgctggactgggttcccgcccattttccgaccgacgaacatgga
cttcgctggttcgatggcaccgcactctatgagcacgccgatccgcgtcagggtttccat
cccgactggaacacggcgatctataatttcggccgcgtcgaggtcatgtcttacctcatc
aacaacgcgctttactgggctgaaaaattccatctcgacggcctgcgcgtcgatgcggtc
gcctcgatgctctatctcgattattcccgcaaggaaggcgagtggatcccgaacgaatat
ggcgggcgtgaaaatctcgaatccgtgcgcttcctgcagaagatgaattccctcgtttat
ggcacccatccgggcgtcatgacgattgccgaggaatccacctcctggccgaaagtgtcg
cagcccgttcatgagggtggcctcggtttcggtttcaagtggaacatgggcttcatgcac
gacacgctgagttatttctcgcgggagcctgtgcatcgcaagttccatcatcaggaactg
accttcggcctgctttacgccttcaccgaaaatttcgtgctgccgctgtcccacgacgaa
gttgtgcacggcaaggggtcgctgatcgccaaaatgtccggcgatgactggcagaaattc
gccaatctccgctcctattacggcttcatgtggggttatcccggcaagaagctgctgttc
atgggtcaggaatttgcgcagtggagcgaatggagcgaaaagggcgcgctcgactggaac
ctgcgccaatatccgatgcatgagggcatgcgccgcctcgtgcgtgatctcaacctcacc
taccgatccaaagccgccctgcatgcccgggactgcgaacctgacggcttccgctggctt
gtggtcgatgatcacgagaattccgtcttcgcctggctgcgcacggcgcccggcgaaaag
ccggtcgcggtcatctgcaacctcaccccggtctatcgggaaaactattatgtgccgctg
ccccaggcggggcggtggagggagattctcaacaccgatgccgaaatttatggcggcagc
ggcaagggaaatggcggacgcgttcaggcggtcgatgccggcggcgatatcggggcgatg
ctcgtcctgccgccgctcgccacgatcatgctcgagccggaaaactga

DBGET integrated database retrieval system